2JNT


Conserved Protein Domain Family
OS-D

?
pfam03392: OS-D 
Click on image for an interactive view with Cn3D
Insect pheromone-binding family, A10/OS-D
Statistics
?
PSSM-Id: 397457
Aligned: 124 rows
Threshold Bit Score: 94.4874
Threshold Setting Gi: 645028440
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2JNT_A         1 YTDKYD-KINLQEILENKRLLESYMDCVLGKGKCTPEGKELKD-HLQEALETGCEKCTEAQEKGAETSIDYLIKNELEIW 78  domestic silkworm
5_pfamImport   1 --RLFDpDIDVDAVLDNDRVLNAYMACFFDEGPCAERPKLVKS-KIREVLESTCGKCNERHRQRLKYVLNKFIERRPEDW 77 
XP_001947629  49 flsTLE-KIDIDQILNNHRLMSNNVKCFLNEGPCTAQLREMKK-MLPALVKDSCASCTKEQKNIIKKSMEAIQARRPNEY 126 pea aphid
NP_001119649  40 YMKRFE-KLNVEQVLNNDRVLASHLKCFLNEGPCVQQSRDLKR-VIPVIANNSCNGCTEKQKTTIKKTLNFLRTKKPDEW 117 pea aphid
XP_001951447  62 YLSTYD-NLDVGHLLRNKKVVSGFVKCFVNEGPCTPDGKLVKAyLLPEIIRTVCGKCTPRQKDMSRAVLRHLYTYRRADF 140 pea aphid
OWR49809      21 YDSRYD-YYDIDHFVQNPRLLKKYIDCFLDKGPCTPIGRVFKL-VLPEIVITACNKCSPSQKRFAHRTFEAFRNISPQNY 98  Danaus plexippu...
Q3LB95        21 YSSEND-DLDIEALVGNIDSLKAFIGCFLETSPCDAVSGDFKK-DIPEAVAEACGKCTPAQKHLFKRFLEVVKDKLPQEY 98  domestic silkworm
OWR49810      19 YNSEND-DLDIEKLVSDPASLGAFLDCFNDKGACDELSGDFKK-DLREAVEQACEKCTAAQKHIFKRFLEVIKVQKADDY 96  Danaus plexippu...
SAJ59009      22 Y------EVNVEEILNNKRLLDAYTKCYLDRGPCPGPARESKK-KLGEVFTTNCAKCNKKQRQDTRAALRKLRERKPQLF 94  Triatoma brasil...
SAJ59011      28 YYQVFE-EIDVDIILDNERLLRSYLTCFFDEAPCSAHAAAVKE-SIPEVMSTVCGKCNDKQKAIYKHALNKFIPTHKEDW 105 Triatoma brasil...
2JNT_A        79 KELTAHFDPDGKWRK 93  domestic silkworm
5_pfamImport  78 KRILEIYDPEKAFR- 91 
XP_001947629 127 KQVSKFFDPEGKYQK 141 pea aphid
NP_001119649 118 ARLVKIYDPTGTKLN 132 pea aphid
XP_001951447 141 DKIMQIYDTDNKKNe 155 pea aphid
OWR49809      99 AELRRKLDPQNKHFN 113 Danaus plexippus plexippus
Q3LB95        99 EAFKTKYDPQGKHFd 113 domestic silkworm
OWR49810      97 KIFQQKYDPENKYLp 111 Danaus plexippus plexippus
SAJ59009      95 LEIFEKYDAGSKHld 109 Triatoma brasiliensis
SAJ59011     106 DHILRIYDPNGEYWp 120 Triatoma brasiliensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap