Conserved Protein Domain Family
MobA_MobL

?
pfam03389: MobA_MobL 
MobA/MobL family
This family includes of the MobA protein from the E. coli plasmid RSF1010, and the MobL protein from the Thiobacillus ferrooxidans plasmid PTF1. These sequences are mobilisation proteins, which are essential for specific plasmid transfer.
Statistics
?
PSSM-Id: 397454
Aligned: 39 rows
Threshold Bit Score: 224.473
Threshold Setting Gi: 120596814
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CBL39244                     17 KSVISASAYLNGDVMKNEETGRISYYTSKKEVVYTSLMMCENApPEWQIvpeenikrfqksvrykrsedkeaalekfkit 96  ...
WP_007745664                 17 RSAIASAAYRSGEKLFDQREGKSYFFARSV-MPESFILIPKNA-PEWAN------------------------------- 63  ...
Ziola:PECL_1916              12 RSAIASAAYRSGERLFDDKEGRNYFYARTV-MPESFILSPKNA-PDWTS------------------------------- 58  ...
Q03N47                       17 RSAIAGAAYRSGEKLFDQKEGRSYFYARSV-MPESFILTPKNA-PKWAS------------------------------- 63  ...
CBL01955                     17 QSAVAAAAYQSGEKLFCEYDQEVKHYPEKRGIVHNEILLPANA-PLEYT------------------------------- 64  ...
CBL01701                     17 QSAVASAAYQSGERLFSEYDQKQKYYSHKSEIVHTEIMLPPHA-PPAYA------------------------------- 64  ...
BAG08391                     19 hSVIAKAAYNARDKLQDEYYGKTHDYSKKEDLVFSKIFLPEHI-PKEFS------------------------------- 66  ...
WGS:ADGE:HMPREF0389_00162.1  17 KSAVAASAYRSGEKIKNEYDGIVHDFTRKSGIAHTEILLPQNA-PQEFA------------------------------- 64  ...
CCY69186                     17 kcAVASAAYISGQKLKDTRLGLSFNYTRKEEVVFAEVLLPKNA-PEDLA------------------------------- 64  ...
CBL37430                     17 kSIISASAYLNGDVMKNEETGRISYYTSKKEVVYTSLIMCENApPEWLHvpeenikrfqqsirykraddkeavlekfkit 96  ...
CBL39244                     97 fQKQRLWNEVLKIEKNADAQLGRSFEFALPKEWSRQEQIQYTTDYIQKTFVDRGMCADWSIHDKGD----GNPHVHLLLT 172 ...
WP_007745664                 64 -DREKLWNEVERKDRKSNSRYAKEFNVALPIELNESEQKTLLTNYVQEDFVDSGMVADVAIHRDHP----DNPHAHVMLT 138 ...
Ziola:PECL_1916              59 -DRERLWNEVERKDRRANSRYAKEFNVALPVELNEDEQKELLTKYIQKKFVNDGMVADVAIHRDHP----DNPHAHVMLT 133 ...
Q03N47                       64 -DREQLWNEVEKKDRKSNSRYAKEFNVALPIELSTDEQKELLTKYVQDNFVDQGMVADVAIHRDHP----DNPHAHVMLT 138 ...
CBL01955                     65 -DRNTLWNAAEAVEKQWNSQLARRWVLSIPREIPPDQYAALVRDFCRQQFVSKGMCVDFAIHDKGD----GNPHAHVMLT 139 ...
CBL01701                     65 -DRNTLWNAAEAIEKQWNSQLARRIVLAIPREIPPEQHADLIRDYCREFFVSKGMIADFAIHDKGN----GNPHAHILLT 139 ...
BAG08391                     67 -NREYLWNSVEKIEKSKNSQLARNLLFTLPRELNEQDRIKLISEFIEENFTSKGMIADCNIHNPMAsdheEQPHAHILLT 145 ...
WGS:ADGE:HMPREF0389_00162.1  65 -NRSVLWNSVEKIEKSKNSQLAREIEIALPKELDQEKQIELVREYVKENFVKVGMCADIALHDKND----GNPHCHILIT 139 ...
CCY69186                     65 -DRETLWNAVEKRENKRNSQYAREFEIAVPNEWNREQTISRMREFIKENFVNKGMAADWAYHEKE-----GNHHVHCMCT 138 ...
CBL37430                     97 fQKQRLWNEVLKIEKNADAQLGRSFEFSLPKEWSRQEQIDYTTEYIQKTFVDKGMCADWSIHDKGD----GNPHVHLLVT 172 ...
CBL39244                    173 MRPFNPDHSwgkkevkdwdfvrdkngnivideshpnwwqdkknpdrhGIRipvldengiqkig----arnrlqwkrvltd 248 ...
WP_007745664                139 NRPFNPDGTwgikskk------------------------qyildknGNKtytgtsky---------------pksrkml 179 ...
Ziola:PECL_1916             134 NRPFNPDETwglkskr------------------------enildenGNKtytgnsrf---------------pksrkvw 174 ...
Q03N47                      139 NRPFNPDGTwglkakt------------------------qyikdenGKQlltksgf----------------pkqrkiw 178 ...
CBL01955                    140 MRAMDERGKwlpksrk------------------------vyeldknGERiklpsgr----------------wkshked 179 ...
CBL01701                    140 MRAMDENGKwlpksrk------------------------vydldenGERirlpsgs----------------wkshked 179 ...
BAG08391                    146 LREIDEKGNwkpkcrk------------------------eyildenGEKiklksgn----------------yksrkvn 185 ...
WGS:ADGE:HMPREF0389_00162.1 140 MRPLNEDKTwgakskk------------------------eyildenGEKiklkngn----------------yktrkin 179 ...
CCY69186                    139 MRAFNKDGSwsnmrkt------------------------efarddnGNKiplldengkqkvrirkgkgeeklwkridvi 194 ...
CBL37430                    173 MRPFNPNHSwgnkevkdwdfvrdtdgnivvdeshpdwwqdkknpdrhGIRipvldengvqkvg----arnrkqwkrvltd 248 ...
CBL39244                    249 ATGWNNPKNCELWRSEWAKVCNEHLPLHN---QVDHRSYEKQGKLQIPTIHEGADARKIEQK 307 Anaerostipes hadrus
WP_007745664                180 LIDWDKKEKIDEWRHNWATSVNQVLAQKNlpdRISEKSFAGQGIDAVPTQHIGINSKRQERR 241 Oenococcus kitaharae
Ziola:PECL_1916             175 LVDWDKKEKINQWRHNWAVSVNQVLEQKNipdRISEKSFVDQGIDEVATQHEGINSKRYERK 236 Pediococcus clauss...
Q03N47                      179 LVDWDKKEKINEWRHNWATSVNQSLAQKNipdRISEKSFVDQGIQETPTQHEGINSQRQNRK 240 Lactobacillus brev...
CBL01955                    180 TVDWNDRKYGEIWRHEWEVIQNRYLEANNrpeRVDLRSYERQGLDIIPTVHEGAAVRQMEKR 241 Faecalibacterium p...
CBL01701                    180 TVDWNDQKYGEIWRQGWAATANRYLEANGrpeRLDLRSYERQGLDKIPTVHMGPAVSQMEKR 241 Faecalibacterium p...
BAG08391                    186 LNDWNEPDKAKEWRENFSKKANEYLARNNinkRIDPRTFKEQGREELPQIHLGTSSYQMEKK 247 Finegoldia magna A...
WGS:ADGE:HMPREF0389_00162.1 180 TTDWNEQDKAEEWRKAWADITNKYLEENSiqeKVDHRSYQRQGIEQIPTIHMGVSASQMEKK 241 Filifactor alocis ...
CCY69186                    195 QNQWNSKEQLKEWRKNWADYCNKFLIEe---qKIDHRSFEEQGLDIEPTIHEGYAARQMEQK 253 Eubacterium sp. CA...
CBL37430                    249 ATGWNNPKNCELWRSEWARMCNQHLSVDN---QIDHRSYERQGKLKVPTIHEGPDARKIEEK 307 Anaerostipes hadrus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap