3FRT


Conserved Protein Domain Family
Snf7

?
pfam03357: Snf7 
Snf7
This family of proteins are involved in protein sorting and transport from the endosome to the vacuole/lysosome in eukaryotic cells. Vacuoles/lysosomes play an important role in the degradation of both lipids and cellular proteins. In order to perform this degradative function, vacuoles/lysosomes contain numerous hydrolases which have been transported in the form of inactive precursors via the biosynthetic pathway and are proteolytically activated upon delivery to the vacuole/lysosome. The delivery of transmembrane proteins, such as activated cell surface receptors to the lumen of the vacuole/lysosome, either for degradation/downregulation, or in the case of hydrolases, for proper localization, requires the formation of multivesicular bodies (MVBs). These late endosomal structures are formed by invaginating and budding of the limiting membrane into the lumen of the compartment. During this process, a subset of the endosomal membrane proteins is sorted into the forming vesicles. Mature MVBs fuse with the vacuole/lysosome, thereby releasing cargo containing vesicles into its hydrolytic lumen for degradation. Endosomal proteins that are not sorted into the intralumenal MVB vesicles are either recycled back to the plasma membrane or Golgi complex, or remain in the limiting membrane of the MVB and are thereby transported to the limiting membrane of the vacuole/lysosome as a consequence of fusion. Therefore, the MVB sorting pathway plays a critical role in the decision between recycling and degradation of membrane proteins. A few archaeal sequences are also present within this family.
Statistics
?
PSSM-Id: 397437
Aligned: 33 rows
Threshold Bit Score: 114.271
Threshold Setting Gi: 115502472
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3FRT_A  14 EWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAKEMIRSRKAVSKLYASKAHMNSVLMGMKNQLAV 93 
Q9UQN3  16 EQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQ 95  human
Q9VRJ5  18 ENDRSLRKATRDIERERRKMEEEERKLELEIRRNAAAGNNDACRILAKQLVEIRKQKSRTYAAAGKIQSIGYQNKNMGAN 97  fruit fly
Q941D5  16 ESKREMTQATRGIEKEIGSLQSEEKKLVLEIKRTAKSGNEGATKILARQLIRLRQQIANLQGSRAQMRGIATHTQAMHAH 95  thale cress
Q9SKI2  18 ENKRMLDKSIREIERERQGLQTQEKKLINEIKKTAKQGQMGAVKVMAKDLIRTRHQIEKFYKLKSQLQGVSLRIQTLKST 97  thale cress
O43633  17 QNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSN 96  human
Q9VBI3  17 KNQRALNKAMRDLDRERMKMEQQEKKIIADIKKMAKEGQMDAVKIMAKDLVRTRRYAKKFMLMKANIQAVSLKIQTLKSQ 96  fruit fly
P36095  19 RIRSVLRKNGRNIEKSLRELTVLQNKTQQLIKKSAKKNDVRTVRLYAKELYQINKQYDRMYTSRAQLDSVRMKIDEAIRM 98  Saccharomyces cerevis...
Q9VN02  18 EWTHKIRKEGNQLDRQIRSIQREEEKVKRSLKQAAQKNDRDTCVILAKEIVNARKAINRIYTSKAHLNSIQMQMKNQLST 97  fruit fly
Q9Y3E7  18 EWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAKEMIRSRKAVSKLYASKAHMNSVLMGMKNQLAV 97  human
3FRT_A  94 LRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFESM---DDQeeMEEEAEMEIDRILFEITA 170
Q9UQN3  96 MKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIf-dGSD--DEEESQDIVNQVLDEIGI 172 human
Q9VRJ5  98 IALSEAMGTTAKTMGEMNKVMRPEAIGETVRQFQAANMKMEMTDEMINDTLDDMl-nESG--DEEESNAVVNKVLDEIGI 174 fruit fly
Q941D5  96 TSVAAGMQGATKAMAAMSKNMDPAKQAKVMREFQKQSAQMDMTTEMMSDSIDDAl-dNDE--AEDETEDLTNQVLDEIGI 172 thale cress
Q9SKI2  98 QAMGEAMKGVTKAMGQMNRQMNLPSLQKIMQEFERQNEKMEMVSEVMGDAIDDAl-eGDE--EEEETEDLVSQVLDEIGI 174 thale cress
O43633  97 NSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAm-gDEE--DEEESDAVVSQVLDELGL 173 human
Q9VBI3  97 NTMAQAMKGVTKAMQNMNRQLNLPQIQKILQDFEKQSEMMDMKEEMINDAIDDAm-eDEG--DEEETDAVVSQVLDELGL 173 fruit fly
P36095  99 NTLSNQMADSAGLMREVNSLVRLPQLRNTMIELEKELMKSGIISEMVDDTMESVgdvGEE--MDEAVDEEVNKIVEQYTN 176 Saccharomyces cerevis...
Q9VN02  98 LRVAGSLQKSTEVLQAMQSLVRYPELAGIMRDMSKEMMKAGIIEEMLDETMDSLe-eSEE--LEEEASKEVDKVLWEITD 174 fruit fly
Q9Y3E7  98 LRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFESMd-dQEE--MEEEAEMEIDRILFEITA 174 human
3FRT_A 171 GAlGKAPSKVTDA 183
Q9UQN3 173 EIsGKMAKAPSAA 185 human
Q9VRJ5 175 EIsGKMSSIPATG 187 fruit fly
Q941D5 173 DIaSQLSSAPKGK 185 thale cress
Q9SKI2 175 DInQELVNAPSGA 187 thale cress
O43633 174 SLtDELSNLPSTG 186 human
Q9VBI3 174 QLgEQLGDLPSAS 186 fruit fly
P36095 177 EKfKNVDQVPTVE 189 Saccharomyces cerevisiae S288C
Q9VN02 175 GKlGEAPLPPEAT 187 fruit fly
Q9Y3E7 175 GAlGKAPSKVTDA 187 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap