Conserved Protein Domain Family
Pox_TAP

?
pfam03355: Pox_TAP 
Viral Trans-Activator Protein
These proteins function as a trans-activator of viral late genes.
Statistics
?
PSSM-Id: 146143
View PSSM: pfam03355
Aligned: 5 rows
Threshold Bit Score: 440.387
Threshold Setting Gi: 123802160
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q98235   1 MSVRIKIDKLRQIVTYFSEFSEEVSVNVDARSELMYIFSTLgGAVNIWAIVPLNANVFYDGGENCVFNIPVLKIKSCLCS 80  Molluscum contagiosum...
Q070H1   1 MSLRIKLGKLKEIVSFFSEFSEEISLNVDRANSTLYIFSSL-GAVNIWSIVPIQSNIFCDGDVGFVFNVPVIKVKNCLSS 79  Crocodilepox virus
P15908   1 MSLRIKIDKLRQLVTYFSEFSEEVSINIDVKSNVLYIFATLgGSINIWTIVPLNSNVFYNGVENTVFNLPVLKVKNCLCS 80  Fowlpox virus strain ...
Q6TVS5   1 MTLRIKLEKLKQIVTYFSEFSEEVSVNVDVGDGLMYIFAALgGSVNIWTIVPLSASVVYDGDVSRVFNLPVLKVKACLCS 80  Orf virus
Q6TUV5   1 MSLRIKIDKLRQIVAYFSEFSEEVSINVDASSNIMYIFAALgGSVNIWAMVPLSSSVFYEGENNKVFNLPVSKVKSCLCS 80  Yaba monkey tumor virus
Q98235  81 FHNDAVVTIEPDlqNDAVRLSSDHMVSVDCNHEPIPHRTGTVISLGIDQKKSYIFNFQRYEEKCCGRTVIHLELLLGFIK 160 Molluscum contagiosum...
Q070H1  80 FHHDSLVTLSAG--DGCVTLSGEHVVAVTIRDRNREHRTDTSISLSVGQDKFYIFNFLKYEEKCCARTIVSLDLLLGFIK 157 Crocodilepox virus
P15908  81 FHNDAVVSITADhdNNTVTLSSHYTVSIDCNNEQIPHSTGTSISLGIDQKKSYIFNFHKYEEKCCGRTVFHLDMLLGFIK 160 Fowlpox virus strain ...
Q6TVS5  81 FHPDSVVSLEPDleDNVVRLSSHHVVSVDCDNEPVAHRTNTAICLGINQRKSYVFNFRRYEEKCCGRTIVNLDLLLGFIK 160 Orf virus
Q6TUV5  81 FHNDAIIEIEPNieNDLVKLSSYHIVSVSCNKELMPIRTDTCISLKINQKKSYVFNFHKYDEKCCARTVIHLELLLGFIK 160 Yaba monkey tumor virus
Q98235 161 CISQYQYLSIGFA-DKNLVLKTPGTRDTFVRRYSMTEWSPALQAYSFKIAIFSLNKLRGFKKKVVMFETKIVMDADDNIL 239 Molluscum contagiosum...
Q070H1 158 SINNYQFLTVAVDgDCNLILRTPGSKDVFVMRYSTTECSDELQNYTFRVPICSLTKLKGFKKKISVFEMRVVMDVDSNIL 237 Crocodilepox virus
P15908 161 CISQYQYLNICFD-DKKLLLKTPGTRDTFVRSYSMTEWSPTLQNYSFKIAIFSLNKLRGFKKRVLVFESKIVMDTEGNIL 239 Fowlpox virus strain ...
Q6TVS5 161 CIHQYQYITVCFR-DKKMVLHTPGKVDNFFREYSMTEWAPDLERFSFKIPISSVNKLRGFKKRVVMFESRVVMDADDNII 239 Orf virus
Q6TUV5 161 CISQYQHLTVLFK-NDNIILKTPGNLDTFSREYSMTECSPDLQKFSFKMAIASLNKLRGFKKRVNVFETKIVMDNDDNVL 239 Yaba monkey tumor virus
Q98235 240 GLLFRDRIGTYRVNVFMAFQD 260 Molluscum contagiosum virus subtype 1
Q070H1 238 GMLFRERLGKDLINVFIPFCD 258 Crocodilepox virus
P15908 240 GLLFRDRIGTYKVNVFMAFQD 260 Fowlpox virus strain NVSL
Q6TVS5 240 GMLFTDRVGMYRVNVFMSFQD 260 Orf virus
Q6TUV5 240 GMLFSDRLQSFKINIFMSFQD 260 Yaba monkey tumor virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap