3DWO,2R88


Conserved Protein Domain Family
Toluene_X

?
pfam03349: Toluene_X 
Click on image for an interactive view with Cn3D
Outer membrane protein transport protein (OMPP1/FadL/TodX)
This family includes TodX from Pseudomonas putida F1 and TbuX from Ralstonia pickettii PKO1. These are membrane proteins of uncertain function that are involved in toluene catabolism. Related proteins involved in the degradation of similar aromatic hydrocarbons are also in this family, such as CymD. This family also includes FadL involved in translocation of long-chain fatty acids across the outer membrane. It is also a receptor for the bacteriophage T2.
Statistics
?
PSSM-Id: 397432
Aligned: 12 rows
Threshold Bit Score: 378.259
Threshold Setting Gi: 501399033
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3DWO_X         2 GFMVPTTNTAGW-GRAMAGGSLfPN-DPSAAFNNPAAMAFIDK--RI--AQLTVNYADIDIKYNGDAYDYQGnpMTGgyq 75  Pseudomonas aer...
Q9A6J9        27 AFYLQEQSVRGT-GRAYSGEVA-DK-GVGSLWWNPASIAGIAR--SEahFGLNQILVNSEVTNTGSSITRPVppAGLtt- 100 Caulobacter vib...
WP_012430599  24 TDVFNLEGFGPV-SRAMGGTGAaFDiGPAAMMENPATLGLMGE--GRh-FSLGLDVVSTDIKVTNTATGETAs------- 92  Ralstonia picke...
Q9PEH5        31 AFQLKENSAKAL-GRSFAGAASaQD-DAAIIVNNPAGMRQLDG--RQ--FQADLSTVRFSAEYRGNPGIYRN--GNT--- 99  Xylella fastidiosa
Q9I2X5        25 AQMANDLTIGNPkAMALGNAVTaDEtGIDSVHYNPAALTRMKGrqATvkLLTGVMDIRAGFKAPPNYGEGTFglRDDpva 104 Pseudomonas aer...
Q4KCI9        30 GFTTPTYGAPGW-GRAFGGGSLfKN-DPSAAYNNPAAMAFIDQ--NV--AQMTVDYARIKMKYKGDAYDYQGnpATTlpv 103 Pseudomonas pro...
Q9I456        25 GIAINEQSASGA-GTAYAGRASsAL-DASTIYGNPAGLSKLKR--TE--VSGGLAIVKAKDDISQAHSTAQG-------- 90  Pseudomonas aer...
Q9KT63        27 GFQLAEYSATGL-GRAYAGEAAmAD-NASAQWRNPAMLTYLEG--TQ--VSAGAIYVNPNVDVEGTVNHAQL--GK---- 94  Vibrio cholerae
Q9KT62        27 GFQLNAQSATGL-GRAFAGDAViAD-NAAVMSRNPAAMALFDE--MA--LSLGFETITTMIDVKNVSYRGVL--GNS--- 95  Vibrio cholerae
Q9KL84        23 GFQVAEHSASGL-GRAFSGEAAvAD-NASVLARNPAAMMLFET--AQ--FSGALSIVDPEVNVDDLSNNQSM-------- 88  Vibrio cholerae
2R88_A         2 GFQLNEFSSSGL-GRAYSGEGAiAD-DAGNVSRNPALITMFDR--PT--FSAGAVYIDPDVNISGTSPSGRS-------- 67  Escherichia coli
P80603        27 AFQLAEVSTSGL-GRAYAGEAAiAD-NAAVVATNPALMSLLKQ--PE--ISVGAIYVDPNINLTSPMPGFAY-------- 92  Pasteurella mul...
3DWO_X        76 dg----pgtpeLGTNDGGQAGFGAWLPTGFLVVPI--NDRFAFGLSQVVPMGMRSTWDP-NWKGRD-------FAVDTKI 141 Pseudomonas aer...
Q9A6J9       101 ---------avGGADAAFDPINNGIVPNFGAAWKI--NDKLSLGLSVAAPYNFTTEYTA-NSWTRY-------DALKSQL 161 Caulobacter vib...
WP_012430599  93 -------------sGNHGNNNGPYFAPQTAFVYR---QGRYAFGAGIFAEGGLGTQYGGsSFLSRTsngvdtgLDQFSRL 156 Ralstonia picke...
Q9PEH5       100 -----------IGGGNGGDAGMVALLPDSYFHMPLgdNNNVHLGATLNAPFGFSTKYDR-NWTGRY-------HGIYSKL 160 Xylella fastidiosa
Q9I2X5       105 nshsrtltptmYLPGLGGMTDVPLLVAPLAGISINppGSKFTFATNVYTPQALGYSRDSdSDPARY-------QGREVSL 177 Pseudomonas aer...
Q4KCI9       104 dasgvptsgpvPLEGNGGQGGFTAWLPTGFMVMPI--NDQFAFGLSQVVPMGMRSTWDNdNSKIRD-------FSVDTKI 174 Pseudomonas pro...
Q9I456        91 --------------SNKGDSVPLAAVPFGYFSTPI--NEDFTFGLGIYVPYGIINDYEN-GFMGSS-------HGSYSKV 146 Pseudomonas aer...
Q9KT63        95 ------------THASSNDFAHDAVIPNFYLSHQL--NEQMALGFALGTNYGMETDLGT-EFAASH-------FGNQASV 152 Vibrio cholerae
Q9KT62        96 -----------VSVQDTDDVGGTSVAPNIHLIVPV--NEQFAWGVNAYSNFGTKTEFSD-SYPASE-------YGGLTDV 154 Vibrio cholerae
Q9KL84        89 -----------------KDVAPLQIVPAAYYIRPI--NDQWAWGLAMFTTYGVATDYPN-EIYAGD-------LAGDTSL 141 Vibrio cholerae
2R88_A        68 --------------LKADNIAPTAWVPNMHFVAPI--NDQFGWGASITAN-DLATEFND-TYAGGS-------VGGTTDL 122 Escherichia coli
P80603        93 -----------------KNIAPNALVPTVYGVYPI--NEKFAVGGGLNVNYGLATEFDD-KYAGGF-------LGGKTDL 145 Pasteurella mul...
3DWO_X       142 ETIG-LTGSLSFKVNDNFSLGAGVIIQRTSGFVsqnldly--------------------asaanspGMGGIPFP---AS 197 Pseudomonas aer...
Q9A6J9       162 RTVN-VEGVVAYRVNDMLDLGLGVTAMYADAEL----------------------------------TNALPNIS---PL 203 Caulobacter vib...
WP_012430599 157 LVLR-VPFSAAYHVTDKLTVGASVDAVWTSLNLgtlldvsqigtlag-------qgrvsgtlvptllGVPGLSGGs-iDF 227 Ralstonia picke...
Q9PEH5       161 QAID-LGIAVSYDVNPYVSFGGAVFAERLNVDLsnaidf-----------------------gsilnARHVPNFS---PG 213 Xylella fastidiosa
Q9I2X5       178 QRLTyFSPTLAYQVNDELSVGLSVGFSHQAVALnedfrapnqllgllqqtkeigclpgmqeilevffNVCGGNIGp--FQ 255 Pseudomonas aer...
Q4KCI9       175 ETVG-LTGSLSFKVNDDFSLGAGVIVQHSKGFVsqnlnlt--------------------gaaavspGLGGIPLP---SG 230 Pseudomonas pro...
Q9I456       147 QVIT-VQPTIAWKINDKVSVGFGPTFNRIDGQLk-----------------------------------nTLATNgllGS 190 Pseudomonas aer...
Q9KT63       153 ISKE-ANLNIAYQILPQLSIGGGVRYVMGEGHFgatapa----------------------knlirhPVTNNVMT---LP 206 Vibrio cholerae
Q9KT62       155 KSFN-LGLAGSYRVNKEWSFGAGLDLIYGQGTMkriagts--------------------fpastivVNPTTVIP---AR 210 Vibrio cholerae
Q9KL84       142 ISVN-LNPNIAYRVNPELSLGFGLDLVAAKAKLtrh-----------------------------kgGLAPFMGG---GN 188 Vibrio cholerae
2R88_A       123 ETMN-LNLSGAYRLNNAWSFGLGFNAVYARAKIerfagdlgqlvagq-------imqspagqtqqgqALAATANG---ID 191 Escherichia coli
P80603       146 TAIN-FNLSGAYRVTEKFSVGLGLNAVHAKAKLeryagvalk----------------------lkvpnvaqLAA---LP 199 Pasteurella mul...
3DWO_X       198 NSSALMRVKVDNTSPGFFAGAVWKPTDRDTLGFAYHAKIRN-KLKGHYNLYDHDGGLTegaieg-----gtpglAYPGLd 271 Pseudomonas aer...
Q9A6J9       204 QADGLQSLKGDGFAYGYSVGAQLHPSKSLTIGASYRSKLDH-KLDGTVKVSGLLAPIP----------------AASNF- 265 Caulobacter vib...
WP_012430599 228 SRNAPVGGGAQAWGIGGRLGLTYQVTPDTRIGAAYQAKTHVgDLTGQATLSAVSSVAGn--------------------- 286 Ralstonia picke...
Q9PEH5       214 SADGYSHIEGHDTSRGFTLGGLFSPDEKTHLGFSYRSQVEH-NVNNGNAHFAVPENAAavla---------vaaTGTFI- 282 Xylella fastidiosa
Q9I2X5       256 NLANIDLDMQQSLSPSFNLGVLWEPTDWFAWGATYQSESRM-RLKGKYRVDYGQGWQGfwtgvh-----kslggAILGQm 329 Pseudomonas aer...
Q4KCI9       231 VGANLMRVKVDNTSVGWFTGVVWKPTDRDTLGLNYHAKIKN-KMDGKYNVRADAVGRQymtqpagpngeslvelAYPGLk 309 Pseudomonas pro...
Q9I456       191 NGDTKINIKGDDTAIGYNVGVMVDLTDDTTWGLTYHSKVKY-HLGGNTEVKNAPGALGln-------------------- 249 Pseudomonas aer...
Q9KT63       207 KGTTLKYMEGEDNSWGWQVGSAWQINQDHRVGFAYKSEVVM-DFEGHAEG------------------------VSYGS- 260 Vibrio cholerae
Q9KT62       211 GTSLLNVDKADGWAVGFNLGTVYEMDENNRFGLSYRYSPEF-KAKDDYGQ------------------------------ 259 Vibrio cholerae
Q9KL84       189 PSDNLIGMTGETLALGWNIGALYELDEQNRIGFGYRSRVKL-NFDDGEFSSYDSG-------------------IATSA- 247 Vibrio cholerae
2R88_A       192 SNTKTAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKI-DFKGNYSSDLNRAFNNyglp---------iptATGGA- 260 Escherichia coli
P80603       200 ANTVISKLQGDKWGFGWNAGLVYEFNERNRIGIAYHSQVDI-NFKGQYSNHFPLAAAAllqt--------kgitATGGK- 269 Pasteurella mul...
3DWO_X       272 l------rmGASASARL---DIPAYASLDWVHQF-NDRLSLGASATWTEWSSFQDL------------TL-----KSHgn 324 Pseudomonas aer...
Q9A6J9       266 ---------TVDGQAKI---TLPWIANLGARWAV-NDQWTLNGSVSRVGWSEFDAIrv---------sFA-----GGG-- 316 Caulobacter vib...
WP_012430599 287 --------iPLKGDVTVrnfQMPAQLTVGISHQF-NDQLSVSADYQRVFWSSVMKDmtv------gfvQS-----GSGan 346 Ralstonia picke...
Q9PEH5       283 ---------NTKIKSTI---RLPASATTSFTHAI-DDRWSIMAEVTRTAWSKFDKIti---------hFA-----SSQp- 334 Xylella fastidiosa
Q9I2X5       330 fpygnvdeeHGNATMNM---VYPDAFSTGVKLRP-FKKWQFNFDLKWNGYSDWNEFkiefdreldllrIAkyldsKDAts 405 Pseudomonas aer...
Q4KCI9       310 ln-----pdGANASAQL---DIPASAGLDWVHVF-DDRFTLGASMLWTQWSSFKDL------------TL-----KSDgn 363 Pseudomonas pro...
Q9I456       250 --------gKYDAKLDI---TLPESVDTSITHKF-DDKWTGYLGAVWTRWSRLEKIevrnsgvpalgqALgf-------- 309 Pseudomonas aer...
Q9KT63       261 ---------YKPGMMSV---TLPATAELASFHQL-NDQWAIHASINWTDWSSFKELta---------vFP-----EKs-- 311 Vibrio cholerae
Q9KT62       260 -------------EITL---PLPDIAEFSGFHKIeNTQFAVHYSVQWIGWSAFDKIefrnlvtsrssvGA-----LTKg- 317 Vibrio cholerae
Q9KL84       248 ---------VVPGQLKI---ELPAIWELSGFHQL-NEQWAVHYSYQQTDWSSFEELta---------tSS-----QCKng 300 Vibrio cholerae
2R88_A       261 ---------TQSGYLTL---NLPEMWEVSGYNRV-DPQWAIHYSLAYTSWSQFQQLka---------tST-----SGDt- 312 Escherichia coli
P80603       270 ---------EIPGTLHL---PLPAYWEISGYHKM-TDRFAMHYSYKYTQWSKFKELra---------kGT-----DGKt- 321 Pasteurella mul...
3DWO_X       325 tiVSIPYTYRNTWTLAVGGDYKVTDQWTMRAGVAYDQTPTHNATRDPRIPDGDRYFASLGAGYRFQsmPELSIDAAYSRQ 404 Pseudomonas aer...
Q9A6J9       317 --STSPQDYKDVTTYAAGVDYQASPRLTLRAGVQYDPTPTPEIGRTARVPDGDRMMYATGATWAAT--ETLQLDAAISYI 392 Caulobacter vib...
WP_012430599 347 ldLSLPQNYRDISVFGIGAEYRYNAKWTFRGGFHYAQEAIPGNMLLAVVPATPTTSLTGGVSYAIG--KNDVIDFALSVA 424 Ralstonia picke...
Q9PEH5       335 -nNALNFSYRDTTFVALGTEYRFSDMLTLRGGLGYDQTPTTAEYRSVRVPDNNRTWISLGMTWKPS--KQTDYNIGYAHL 411 Xylella fastidiosa
Q9I2X5       406 hsITLDRGYRDTWSWAMGVQYDVNDRLQLRAGYEYRPSAIPKGQADILVPIGDANLYGLGLGYQWD--KDTVIDVGFNYF 483 Pseudomonas aer...
Q4KCI9       364 tlVSIPYKYKDTMMYSLGGDYRFTDQLTLRAGVAYDQTPTRNSTRDPRIPDNDRWFTSLGFGYDIRaiPGLTIDGAYSRQ 443 Pseudomonas pro...
Q9I456       310 ntIGEDLNWRDTWSFSVGTSYQATPEWVLRTGFAYEPSPTSNEDRNVRIPVGDRKVFTVGAGWSPN--QDLTVDVAYAYL 387 Pseudomonas aer...
Q9KT63       312 -dLIKSENWEDNYRFALGTTYQYDAKLALRAGVAYDTSAVDDKNRTATIPETDRTWVSVGGSYVAT--PQLTLDAGFTYI 388 Vibrio cholerae
Q9KT62       318 -sYDKMYEWQDGWHYSIGGTYYLNSDWTLRAGYMYDTSA-QDSRTSISVPDSDRQWLSAGFTYNID--DKSNVDFGFTYL 393 Vibrio cholerae
Q9KL84       301 tcFQKIEQYQDNGRWSVGATYTLNTTWTLRAGLAFDEQA---GKATLSIPDSDRFWYSAGLTYTLT--PQLTMDAGFALV 375 Vibrio cholerae
2R88_A       313 -lFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFN--KDASVDVGVSYM 389 Escherichia coli
P80603       322 -lFSKTEEFRDSSRIALGASYDVTDALTVRTGIAYDESA-ADEHNTISIPDTDRTWFSVGATYRFT--PNVSIDAGFAHL 397 Pasteurella mul...
3DWO_X       405 FVKEVPLKTVN-----QDRL-----GGGRLDGRATSKGQVFSLSATYDF 443 Pseudomonas aeruginosa
Q9A6J9       393 AFDKSQINRTD-----VTATs----STVRLRGDVEGSAVVLAAGARFSF 432 Caulobacter vibrioides
WP_012430599 425 LRKTLDNASQP-----N----------TAVPISVTHSQVNAVIAYQKRF 458 Ralstonia pickettii
Q9PEH5       412 FIGHPTITQIN-----AT--------ASTLVGDYNINTDLLAISINHKF 447 Xylella fastidiosa
Q9I2X5       484 VTKQSVKADNScnlncTGLDnlvynPYAGLDVDTTVKAYIFAMTYRTTF 532 Pseudomonas aeruginosa
Q4KCI9       444 FVKEAKIKTQN-----VDRL-----GASRLDGKVDAKGEVVSLSATYHF 482 Pseudomonas protegens Pf-5
Q9I456       388 WETTAGVNQEG-------SA-----LQPAYSAKYDNSAHGLTAQVTYRF 424 Pseudomonas aeruginosa
Q9KT63       389 FAKDATINEPR-----DASDqtaaaIGGAFTGNVSGNVWLIGVQANYRF 432 Vibrio cholerae
Q9KT62       394 MGKDVAVSEND-----AG---------SKLTATTHADAILLGLQYSRTF 428 Vibrio cholerae
Q9KL84       376 QSRKGSFTEKN-----QI--------GQNLQFESEAVAYISALQFNYRF 411 Vibrio cholerae
2R88_A       390 HGQSVKINE------------------GPYQFESEGKAWLFGTNFNYAF 420 Escherichia coli
P80603       398 KGKKNTFKE------------------EGVPFTSKASANLYGLNVNYRF 428 Pasteurella multocida subsp. multocida str. Pm70
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap