3SAM


Conserved Protein Domain Family
Pox_Rif

?
pfam03340: Pox_Rif 
Click on image for an interactive view with Cn3D
Poxvirus rifampicin resistance protein
Statistics
?
PSSM-Id: 397427
Aligned: 8 rows
Threshold Bit Score: 714.975
Threshold Setting Gi: 81970500
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3SAM_A  30 IINSLIGG-D--DSIKRSNVFAVDSQIPTLYMPQYISLSGVMTn--dGPDNQAIASFEIRDQYITALNHLVLSLELPEVK 104 Vaccinia virus WR
Q6TVP5   4 SVVSLVGG-D--DAVRRASVFATDHRAPTVYMPQYITTQGVVD----TTSDAVTVTFEIRDKYISAMNNFVLSVDLPEIK 76  Orf virus
O72909   5 IISSVINSiD--SSSKRTNIFSFDVQQPTAYMPQYISVNGYHNkkdnDANQVCSVSFDIRDQHIAAINYFFISIQLPEVS 82  Fowlpox virus strain ...
Q08FQ3   5 VINSLIGN-D--DYIKRHNVFGVDIQNPTLYMPQYITINGIMSgn-nSCDQQVISTFEIRDQYITALSHLILSIELPEVK 80  Deerpox virus W-848-83
Q9Q8L2   5 VINALIGN-E--DYVKRHNVFGVDVQTPTLYMPQYITINGIVSgg-vSCDQPVTSSFEIRDQYITALSHFVLSIDLPEVK 80  Myxoma virus
Q98269   5 IINSLIHA-E--DGVRRSNVFGFDMHQPTLYMPQYVTVSGVLQp---DAGAHPVVAYEVRDQYITAMNNMVLAIELPEVK 78  Molluscum contagiosum...
Q9EMS7   4 TFIPFSKT-N--IDSDRPNIYITETKNGKYNIPQYVSSPCTFQ--------DGYAVASITDIKLEGCNNFGLNITLPEIK 72  Amsacta moorei entomo...
Q070D1   5 IVNSFLGS-RraEAAKSKNVFGVDPQETTYYMPQYITVSGIRC--------DDVVRYEVKDQYINAANYFVLTVPLPEIK 75  Crocodilepox virus
3SAM_A 105 GMGRFGYVPYVGYKCINHVSISS-----CNGVIWEIEGEELYNNCINNTIAlKHSGYSSELNDISIGLTPNDTIKEPSTV 179 Vaccinia virus WR
Q6TVP5  77 GVGKMCYVPYIAYKLIRHVAVNS-----AADTIWETSGEELFDSCLDNERVmELSGFSRELNDLSTGSSPNDVIKEAACV 151 Orf virus
O72909  83 GEGKFAYVPYVGYKCIQHVAITC-----GDITIWETDGEELFDKCVDDKIA-SLSGYSPELNDISTGYTPNDTIKDPTTL 156 Fowlpox virus strain ...
Q08FQ3  81 GIGRFGYVTYVGYKCIQQISISS-----SNGVIWESTGEDLFNSCIDNETAlINSGYSHELNDISTGLTPNDTIKESTTV 155 Deerpox virus W-848-83
Q9Q8L2  81 GIGKFGYVPYVGYKCIQHVSVAS-----TECTIWESSGEDIYNSCVNNETAmANSGYSHELNDVSVGLTPNDTIKDAATV 155 Myxoma virus
Q98269  79 GVGRFAYIPHVGYKCIRNVALTS-----VNGTVWEVSGEELFDSVRGHAAAlELAGHSRELNDITRGDSPNDTIKDASTV 153 Molluscum contagiosum...
Q9EMS7  73 GIGGVRFQNYFIPKLIEECIIETiddnkTNEIIRKTGLEFLMDFIQKKKEYsRFVGNNSDLCKFKYGKCADDIIFPSKEV 152 Amsacta moorei entomo...
Q070D1  76 GVGSFAYAPHVGYKCIKRVQFSS-----QRGLIWEIEGEELFAASRGSNIA-ACSGYSEKLCSMSTGHTPNDVIKESELI 149 Crocodilepox virus
3SAM_A 180 YVYIKTPFDVEDT--FSSLKL-SDSKITVTVTFNPVSDIVIRDSSFDFETF--NKEFVYVPELSFIGYMVKNVQIKPSFI 254 Vaccinia virus WR
Q6TVP5 152 HAYIKTPFDADKT--FSTLKL-SDSKITVTITLNPIACVMVYDETFDAAKL--AKEFPYSMELSFIGYMVKNLCPRPAFI 226 Orf virus
O72909 157 YVYIKSPFDADKT--ISSLKL-VNNKITVTITFRSINDVIVYDSKFQVERF--VKDFVYSTELHLIAYAVSDIKPKSAYI 231 Fowlpox virus strain ...
Q08FQ3 156 HVYIKTPFDVERT--FSSLKL-ADSKIVVTVTFNPVSDIIIRDSTFNYESF--IKDFVYVSELSFIGYMVKNINIKPTYI 230 Deerpox virus W-848-83
Q9Q8L2 156 YVYIKTPFDVEKT--FSSLKL-SDSKVTVTVTFNPVSDVIVRDTTFNYEAF--VKDFVYVSELSFVGYMVKNIQPKQTYI 230 Myxoma virus
Q98269 154 YVYLRSPFDCDHT--FSSLKL-SDAKVTLAVTFNPISDVLVYDAAFDLDAF--LRSFVYATELSFVGYMVRNIHAKPSFL 228 Molluscum contagiosum...
Q9EMS7 153 YFPLMFIFDNVNMnpRTCFRLfPETKLQIKIKFRPFADILLPDVKYKKNSLknISDVDLQPYIKFTGYNTCGSPFKHRYI 232 Amsacta moorei entomo...
Q070D1 150 YVYLRTPFDDEST--ISSLKIpANDKIVIEVAFNRISDVVIYDAAFNIDAF--AHGFVYQPDLSFIGYTVKGLQAKPAYL 225 Crocodilepox virus
3SAM_A 255 EKPRRVIGQINQPT--ATVTEVHAATSLSVYTKPYYGNTD----NKFISYPGYSQDEKDYIDAYVSRLLDDLVIVSDGP- 327 Vaccinia virus WR
Q6TVP5 227 EMPRRRVEQINHTT--AVITDVHACTSLSVYMKPVLSDAN----NRFISYPGFQQSEGDFVMAFVERLLEDMVIVSNCY- 299 Orf virus
O72909 232 ELDRRVVSCSSTPTpiPVISDVYACTAMSVYVKPYYGMME----NKFISYPGYKQTESDYVRCMVNRLLDDLVVVADTV- 306 Fowlpox virus strain ...
Q08FQ3 231 EKPRRILGQINQST--VVVSEVHAITSLSVYVKPYYGNAD----NKFIAYPGYAQTERDYICSFVERLLEDLVIVSDGP- 303 Deerpox virus W-848-83
Q9Q8L2 231 ERPRRVLSQINQAT--AVISEVHSVTSLGLYIKPYYGNTD----NRFISYPGYNQTERDYICAFVERLLEDLVIVSDTV- 303 Myxoma virus
Q98269 229 EITRRQVGQMNLPT--AVVTDVHAATALAVYVKPYYGPVE----NKFIAYPGFSQSEQSYVCAFVERLLEDLIRISDAE- 301 Molluscum contagiosum...
Q9EMS7 233 E-------ELTYSThkSNKKNYYSPEFLSITNLLWYSKSDifrgNMFISYPDYPETEENFIKTYVDKLLKDLLIISDDEn 305 Amsacta moorei entomo...
Q070D1 226 QIPRRVVGSLNITS--NSLGEVYSITSLSVYVKPCYG-IE----NKFIAYPGFDQTPAAYVKAYVERLLFDLLTVSAER- 297 Crocodilepox virus
3SAM_A 328 ---PTGYPESAEIVEV-PEDGIVSIQDADVYVKIDNVPDNMSVYLHTNLLMFGTRKNSFIYNISKKFSAITGTYSDATKR 403 Vaccinia virus WR
Q6TVP5 300 ---PEGFPDTAEIVEV-PPSGVVSIQDTDVFVRIDDVPVGMRVFLHTNILVFATRKNSVVYNMSKKFSAITGAYSRATSR 375 Orf virus
O72909 307 ---PKGFPSTATFVKV-PVDGQINLQDVDIIVKIDNVPDDKDIYYHTNLLIFGTRKNSFVYNISKKFSSIIGMYSPNTDS 382 Fowlpox virus strain ...
Q08FQ3 304 ---PKNFPETSEIVEV-PENGIVTIQDVDVFVKIDNVPCNMSVYLHTNILIFGTRKNSVVYNISKKFSAITGTYSESTRR 379 Deerpox virus W-848-83
Q9Q8L2 304 ---PSTFPDSAEIVEV-PPDGIVNIQDVDVFVKIDNVPKDMAVFYHTNVLVFGTRKNSVVYNMSKKFSTITGTYSEVTKR 379 Myxoma virus
Q98269 302 ---PSGFPEAAELVEV-PPGGLVSIQDVDVLVRIDGVPAGKTVFFHTNLLVFGTRRNSFMYNLSKKFSVIAGCFSPATGK 377 Molluscum contagiosum...
Q9EMS7 306 fikSKGFSDKCKFKKIdPCDKIVFDVNNNCEINIMNVPEGFDLYYHTNILSFSRRNNPNDYNISKKFSKISGTYIPNEDK 385 Amsacta moorei entomo...
Q070D1 298 ---PSNFPPESDIVRI-ASSDIVTIQDIDVSVCIDGVPAGKSLYFHRNLLVFGTRRNGAAYNISKKFSKICGFYNDVNDT 373 Crocodilepox virus
3SAM_A 404 TIFAHISHSINIIDTSIPVSLWTSQRNVYNGDNRSAESKAKDLFINDPFIKGIDFKNK-TDIISR--------------- 467 Vaccinia virus WR
Q6TVP5 376 IRFTTAIHSVNIGDASVPVGVWTCQRNVYNGDNRSPEARAKDLFVADPFLKGVDFKNK-IDVIAR--------------- 439 Orf virus
O72909 383 INFSKVNHTISITDASIPVSFWVSQKNVYQGDNRSNYSKSKDLVVNDPFRKGIDMVNK-TDVISR--------------- 446 Fowlpox virus strain ...
Q08FQ3 380 IMFSQISHSVNITDVSIPVNLWSCQRNVYSGDNRSDASKDKDLFINDPFIKGIDFKNK-TDIISR--------------- 443 Deerpox virus W-848-83
Q9Q8L2 380 IMFSHISHSVNITDVSIPVSIWTCQRNIYNGDNRSEYSKSKDLFINDPFVKGIDFKNK-MDLISR--------------- 443 Myxoma virus
Q98269 378 IIFTSVQHTVSVTDASIPVGFWSSPKNVYHGDNRSCSSRAKDIFVNDPFLKGVDFLNK-AEVISR--------------- 441 Molluscum contagiosum...
Q9EMS7 386 ILIHEVKHTINISDVSIPLSIWNANENTSTGDLRSIKSKKSDIYVNDPFVFGLDFLSKeLGIISRsitsssnesiaeyns 465 Amsacta moorei entomo...
Q070D1 374 IIYTEVLHTVDMLDVSIPVKLWNSERNIQAGDNRSAASKAKDVYINDPFLKGIDLLGS-FDPVER--------------- 437 Crocodilepox virus
3SAM_A 468 ----LEVRFGNDVLYSENGPISRIYNELLtKSNNGTRTLTFNFTPKIFFRPTTITANVSRGKDKLSVRVVYSTMGVNHPI 543 Vaccinia virus WR
Q6TVP5 440 ----MDVRFGNEVLYSENSAVSRVFGEIL-GKTPGVRTLQFNFTPSTFFSPTALNSNVSRGKDKLAVRVTTAHMEAHNPL 514 Orf virus
O72909 447 ----LEVRFGNDPIYSEISPITKVFNMLLtGSSINMRKIIFNMNPANIFRPTTLNANTKRGKDKLTVRISYIDTDPNNPI 522 Fowlpox virus strain ...
Q08FQ3 444 ----LEIRFGNDVLYSETGPISKIYNDLLsNCSCGTRTLRFNFTPHTFFKPTTIIANPSRGKDKISVRVVFCSIDPNNPI 519 Deerpox virus W-848-83
Q9Q8L2 444 ----LEVRFGNDVLYSETAPISKIYNDLLsGCDSGIRMLRFNFTPHTFFKPTTIVSNPSRGKDKLSVRVVFASIDPNNPI 519 Myxoma virus
Q98269 442 ----MEVRFGNDVMYSEIAPISRVYNQVLhGAHCGTRKLLFNFNPGAFFRPTTLTANPSRGKDKLAVRVVYSSMDPNNPI 517 Molluscum contagiosum...
Q9EMS7 466 dtvnIESYFQSDNLFA-VTPTSEYSN-------PAIFLHRFNLHNIIFIEPSRLIADAAKNFRCVNLSIDWKEFPEVDPR 537 Amsacta moorei entomo...
Q070D1 438 ----MEVRFGHELMYSEDFPISRIYNRLLtSAIAAERKLIFNYTQCCLFKPTILQADHSRGKDKLHVKVGYKRLDVDNPI 513 Crocodilepox virus
3SAM_A 544 YYVQKQLVVVCNDLYKVSYDQG-VSITKIM 572 Vaccinia virus WR
Q6TVP5 515 MYVPRQMVVVCNEVYRLSYDAG-IVAEKVT 543 Orf virus
O72909 523 HYVAKQLVVICTDLYRIDYDGN-INITKIT 551 Fowlpox virus strain NVSL
Q08FQ3 520 YYISKQLVLICNDLYKVTNDSG-INVTKIL 548 Deerpox virus W-848-83
Q9Q8L2 520 SYVSKHLVLICHDLYGIHNDSG-INVVKIT 548 Myxoma virus
Q98269 518 SYVPKQLVVVCTDLHRVTYDPY-IRVSKVS 546 Molluscum contagiosum virus subtype 1
Q9EMS7 538 SLFNKELQICQTIVKKISYDNN-IITVHIL 566 Amsacta moorei entomopoxvirus
Q070D1 514 HYVDRQLVLACNDLYRISYDNSeVKVSKIN 543 Crocodilepox virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap