Conserved Protein Domain Family
SDH_alpha

?
pfam03313: SDH_alpha 
Serine dehydratase alpha chain
L-serine dehydratase (EC:4.2.1.13) is a found as a heterodimer of alpha and beta chain or as a fusion of the two chains in a single protein. This enzyme catalyzes the deamination of serine to form pyruvate. This enzyme is part of the gluconeogenesis pathway.
Statistics
?
PSSM-Id: 397412
Aligned: 550 rows
Threshold Bit Score: 84.3795
Threshold Setting Gi: 493344988
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CBH22488        87 KELNVLADITYEdvKQSqQmvaeqkikigvksdinpiyievnaaSgesnskviieekhnnivyiekngevilnnrlqkdt 166 [Clostridium]...
WP_006428913    85 KGLELLEDITPEilEQMkElcgmaavsvkikeqeqglyvkckikTeadmitsvirgthtnlvylekngkiiye------- 157 Dorea longica...
CCX56278        85 KRMELFEDITPDvlNEVdElcnndgvivqinseesgifskctvwTaaeqatciiknahtnivflqknnetild------- 157 Veillonella s...
CDE27465        84 KQLTLFEDIEPDtiTYAeLlvphvsitind---sasihvkctlyTssetvtcmikeahtnivylekngivlee------- 153 Catenibacteri...
A5I389          85 KKLELLEDITAEvsQKAiKivensqvvvvikheeaqlyvraeiiTtagmgiseirgthsniiftkrnndmll-------- 156 Clostridium b...
WP_002576065    84 KGLKLLEDLSPAvsSQAiNlvesgmvtlklkedepllyahaeavSsagtgastirnthsnivctartvngvltp------ 157 Clostridiales
CCX40518        84 NTMEICAGIKPEhvEKAkKlvaegfvhvkvl-kssqfyiectatDgkdtvhtitedehdnlvfcekngevlldk------ 156 Firmicutes ba...
jgi:Hprae_1904  84 KELEVIENVTEAdiKKAqAiidsglinlkvmeevngiyietrvlSaaekarviiidnhlnvvktekikadlef------- 156 Halanaerobium...
CDE51535        84 AGMNALHTVTAEqlAAAkAlrgcvkveivdg--vsglyietilrTdcdavrvvtvgahdhialvehapft---------- 151 Faecalibacter...
WP_014811273    87 KGFCVIDQCTEEdvEKAqEivqqkrvtitvpenctelfietiltTdqekvrvitknqhlnvvsiekgdhfqp-------- 158 Desulfomonile...
CBH22488       167 keeskevsvenkaessskasinqdtgkslkfsvesiydfSVNMPLEELSFVYDLTItnsliSnEGMEkn--ygHRIGRI- 243 [Clostridium]...
WP_006428913   158 -----------knqengqasdnalietlkqmtiaqirqvADTASEEELHFLMDGVEmnerlAaYSEDkk--vgVGIADT- 223 Dorea longica...
CCX56278       158 -----------crggqrlkqddilveklkamtiaqmrnlVDTVSEDELLFLLDGVVmnetlAaYSKSnk--igVGLADS- 223 Veillonella s...
CDE27465       154 ------------kttqetnntptvidklkemkisdirslVDSMTVNELHFLLDGIEmnnrlSqY--KgtthlsDSFNHS- 218 Catenibacteri...
A5I389         157 ------------qkeysvdsddslhqqlklmgiaeirklIDECKEEELSFLLDGVDmnerlAdYGLEhs--lgIGIASA- 221 Clostridium b...
WP_002576065   158 ----------ffqkeysltgrtalheklasmtisqivslVESCSPEELAFMEDGARmnsalAdYGMQhk--lgIGAASS- 224 Clostridiales
CCX40518       157 ----------rvkkeavdseekegtfdvtkhtfsefyhwANEVDVADLQFIKEAIDinmeiAkKGMEkk--yaFGVGPT- 223 Firmicutes ba...
jgi:Hprae_1904 157 ------------etyqievdrkndfgaildfsladiltyIKEVPLAEIEFLQEGVDmnlkvAaEGLKtenslsSKFEEL- 223 Halanaerobium...
CDE51535       152 --------------eapteqesveeggahcgslaefiafADTVALDKLAFLRDALTmnrtiYdRAMs------DELAHCv 211 Faecalibacter...
WP_014811273   159 -------------wdlnaqlpdslahdiqaydledfisfAETVSVSDLSFLQDGIAmnmtiArEGFAikngasQNYAKL- 224 Desulfomonile...
CBH22488       244 -----VQknidnglladDlms--yvIKKSAAGADARMGGCMLPAMSNSGSGNQGItlsVPVIACAEklgsdkEKLTRALV 316 [Clostridium]...
WP_006428913   224 -----LRsekgsevlknDllt--riMLKVSSAAESRLDGCPLPTMSSSGAGTKGLvviLPVSEAADalgvsmEKKVRALA 296 Dorea longica...
CCX56278       224 -----MRtgagqkllsnDims--riMVKVTSAAESRLDGCSMPTMSSSGAGTKGLvviLPVNEMADelqvsvLKRVRALA 296 Veillonella s...
CDE27465       219 -----LFs--------eDllt--riIRKVTAAAENRLDGCPLPAMSSSGAGTKGLvvsIPVNEVAEelhvslEKKLKALA 283 Catenibacteri...
A5I389         222 -----LQekmttdimgdNlfs--rtMLRVASSAEGRMSGCPYAVMSSAGSGNHGItaiLPVTEMARylnssrEQLVKALA 294 Clostridium b...
WP_002576065   225 -----LAkycrtdimgnSlms--riMTLMASSAEGRMCGCPYAVMSSAGSGNHGLttiLPVVETARylgsdkEHLVKALA 297 Clostridiales
CCX40518       224 -----VQdllkkgllksDvvt--avRSIPAAAADFRMSGGNGSVMTFCGSGNQGIsttLPMAVFADrmgipeEKLLRAEF 296 Firmicutes ba...
jgi:Hprae_1904 224 -----IAsgf----lndNlla--kaKMKAAAASEARMNGSKLPIMTSAGSGNQGVvnfITNAVVVEaknlshEKLLRALA 292 Halanaerobium...
CDE51535       212 lpkitLD----------DpslcasaKRMAGAASYARMHGVPLPVMTATGSGNQGItlfLTVDAAARyfsipeEKELRAIA 281 Faecalibacter...
WP_014811273   225 -----VSetf----vsdDmis--laERLCAAACEARMSGSRLPAMTCAGSGNQGItvfLTMEAVAEktgvsqEKLLRALA 293 Desulfomonile...
CBH22488       317 LASLISIYIKSNMKRLSALCGAMTA-GASASCGMTYLLGGNLEQVKFSVQNMIGNLTGIVCDGAKPNCAMKVATGVSAAV 395 [Clostridium]...
WP_006428913   297 IAHLVNRYINAYIGKLSPMCSCVMAsSTAASVGIAYLLGGSDEQLGYAVRNMSGTVTGMICDGGKVGCAMKVATGSSAAL 376 Dorea longica...
CCX56278       297 LAHLVNRYINAQIGKLSPMCACVLAsATAASVGMTYLLEGTNEELGYAVRNMTGTVTGMICDGGKVGCALKVASGSVAAF 376 Veillonella s...
CDE27465       284 LTHLVNRYINVHIGKLSPMCTCVMAsSTSASVGIAYLLDATNDQIGYCIRNMTGTVTGMICDGGKVGCAFKVSTGSTAAL 363 Catenibacteri...
A5I389         295 FSHTLNVYIKLFTGKLSATCGCGVSaATAASAAMVWLMGGNEHQIANAIINMSGNLTGMICDGGKIGCALKLATATNAAL 374 Clostridium b...
WP_002576065   298 ISHSINVYIKEFTGKLSATCGCGVSaASAASASMVWLMGGSHEQMGYAIINMSGNLTGMICDGGKIGCALKLATASGAAL 377 Clostridiales
CCX40518       297 MGMLMIMYMKKYVGRLSPVCGAMLA-GTGSAAGMAYMMGGTVAQVSGAVQNMMGSVAGIFCDGAKGGCAVKVAACASEAV 375 Firmicutes ba...
jgi:Hprae_1904 293 LSNLLTLYIKTATGSLSAMCGVAVAaGVGVSASTVYLLGGGEKEILAASLNVLGSLTGIVCDGAKEGCAYKVATAVDWSI 372 Halanaerobium...
CDE51535       282 LAALANVYIKSFIGPLSSVCACGVAsGLSASLGVVYLLGGGEGEMVQAARNILGSVSGMICDGAKEGCASKVALSAGLAV 361 Faecalibacter...
WP_014811273   294 LSIIITVYCKSFTGTLSPMCGCAISaGVGTSAGVAYLLGGDARRILGAVSNVVGSISGMICDGAKEGCAYKVALASGWAI 373 Desulfomonile...
CBH22488       396 ISSLAAMDNvscTSlEGIVDDNVDKSIANLGKIAAYGMADLDKMMLE 442 [Clostridium] sticklandii
WP_006428913   377 LCALTAVHDaplRVsDGICAETPEDCIRHMAQIGNQGMAQTDKEIIH 423 Dorea longicatena
CCX56278       377 MSTMAAINEaplRVsDGICAETPEDCIRNMARIGQEGMNRVDATILD 423 Veillonella sp. CAG:933
CDE27465       364 MCAMTAVNNavlREsDGICAATHEQCIQNMARIGQNGMIKVDEEIIS 410 Catenibacterium sp. CAG:290
A5I389         375 MCAYLAMSDvalQPsDGICDVTAEQVIRNMGQVSNPGMVETDQTILS 421 Clostridium botulinum A str. Hall
WP_002576065   378 MSACLAVDKtvlDPkDGICHATPEGAIRNMGRISNPGMAQTDRTILE 424 Clostridiales
CCX40518       376 YAAMYAMDGsviGVsDGINSSAAEDTAKNLAKLSHEALDTLDMKVIe 422 Firmicutes bacterium CAG:102
jgi:Hprae_1904 373 IAAKLAIAGkavPQkDGILAASFEELIDNLAYVCQPGMIETDQAILK 419 Halanaerobium praevalens DSM 2228
CDE51535       362 EAACLALEGggiHAqDGILDDSFDRLIAHLGELVCVGMGSTNSTIVH 408 Faecalibacterium sp. CAG:74
WP_014811273   374 KMALLSMRGsviSNtNGILADNFRELFDNLGALCKEGMASANKVILr 420 Desulfomonile tiedjei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap