Conserved Protein Domain Family
Cornichon

?
pfam03311: Cornichon 
Cornichon protein
Statistics
?
PSSM-Id: 397410
Aligned: 111 rows
Threshold Bit Score: 57.1162
Threshold Setting Gi: 121918860
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_015781392   8 F-SYV-FALILDAFLIFFAVFHVIAFDELKTDFKNPIDQCNTLNPLVLPEYIIHITFNV-LFLFAGEWFTVLINIPLIAY 84  two-spotted spi...
Q8SU63         3 aiGFL-ISLVLSTVLCIVELYKIEAVLDAESKRASSYNACDRILWLTDIEFRLLTAMVI-AQCLSLCYTSFFVAL-LFVY 79  Encephalitozoon...
Q381F1        50 IgAWI-ACGLLQVIMLIFAMLFALNIADCRDKCLNVLECERAINPVMEVYIGLRFIQFLhATFLLTNIPMGVSILVALLY 128 Trypanosoma brucei
Q383N8        59 pfSWV-LAFLIQLILFIISVVHTALISEYEERLNNAMELERQLNPLIIAELTFRCFSLF-HLFLLHWWFAFAVGLLEPLH 136 Trypanosoma brucei
Q4DLH3        59 IvTWV-LAFLLQVAALLLSIFHISSVTDYADKMNNAMELEQQLNPLIIAELSIRCFALL-HCLLMGGWLMGIAGLLELAY 136 Trypanosoma cruzi
CAM71147      58 TvSWV-LAFILQSGAMALCVMHLALLEEYADSMTNALELEHMVNPLIIAEAAVRCFASL-QCVLTGSWMLLLAGSIELAY 135 Leishmania infa...
CAM43202      58 MaSWV-LAFILQTGAMGLCVLHLTILEEYADRMNKSLELEHVINPLIIAEASVRCFACL-QCVLSRSWLLLLAGCVEIAY 135 Leishmania braz...
EAY23626       2 WfILL-LGLIGIVALAVLYIIIINSLVDFQIDRINPLDICSTLDKFINP---LKYVHIF-VALTSLGWIKA--AFPILIY 74  Trichomonas vag...
XP_003286609   9 fdftIcLSLIGVGGLIALIVIQLLLLTDLEGNDINSIEFSRRINKLILPEYIIQAVFSV-WFLLTIRWFLFILNLPVLVY 87  Dictyostelium p...
EFA80847       9 fdytMlLALLSSGVLLAIVVYELLLLTDLEGNDINSIEFCKKYNKFIMPEYIVQAVFTV-WFLVTFRFVLFLLNAPVLYY 87  Heterostelium a...
XP_015781392  85 HVYRyihrpAgMSGPGLYDPTTIMNadQMSRATREGWFKLAYY-LLSFFYYLY 136 two-spotted spider mite
Q8SU63        80 EAQK-------KGSGATISALDFFK--QKQRIKIETFCKVSLY-VLLVYRYfm 122 Encephalitozoon cuniculi
Q381F1       129 SLWR-----M-WCGTYFVDATSLWR--EVGRLERDSYIHICIE-IALIVIYLi 172 Trypanosoma brucei
Q383N8       137 NYWS-----Y-RRAHFLVDAATTWK--QLGSLRTDARLRLMIQgLLLILTFAY 181 Trypanosoma brucei
Q4DLH3       137 DYWI-----F-RRGDFLVDATTAWK--KLGALEMDSRVRLAYQ-GVMVIASIF 180 Trypanosoma cruzi
CAM71147     136 DLHV-----T-QHRSLLIDATTIWK--ELETFRTDGRIRTAYQ-ILMVLFAIF 179 Leishmania infantum JPCM5
CAM43202     136 DVYV-----V-QHRSLLIDGTTIWK--EVDIFRTDGRLRVAYQ-LLMIPVCll 179 Leishmania braziliensis MHOM/BR/75/M2904
EAY23626      75 HFLIafhlyYtTRNRRYFEPLTIVR---DSDSKKYKLIAILVG-VVISFVYsm 123 Trichomonas vaginalis G3
XP_003286609  88 HYLR-----Y-SKGLHKVDPTKVYQ--MTSKLGNHLMLKLVFY-MVMFFVYLF 131 Dictyostelium purpureum
EFA80847      88 HFQR-----Y-QTRTHKNDPTKVYS--HTSKMGNHLMLKLVFY-MVMFFIYLF 131 Heterostelium album PN500
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap