5XNE


Conserved Protein Domain Family
AAL_decarboxy

?
pfam03306: AAL_decarboxy 
Click on image for an interactive view with Cn3D
Alpha-acetolactate decarboxylase
Statistics
?
PSSM-Id: 397408
Aligned: 154 rows
Threshold Bit Score: 201.154
Threshold Setting Gi: 81614349
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5XNE_A         4 IYQVSTMTSLLDGVYDGDFELSEIPKYGDFGIGTFNKLDGELIGFDGEFYRLRSD---GTATPVQNGD-RSPFCSFT--- 76  Bacillus subtil...
CAZ98613      54 IHQYAPTVALLNSIYEGDITPRQMVQQGNIGIGTVNHLAGELVAVDGVVYTIDAE---GGIKEAPEDL-ESPNMTMI--- 126 Zobellia galact...
Q15PC6        38 IQQYGLPLTLMNTIYEGTITAEQMSELGDIGVGVSNHLNGELTAVDGVIYSIAAD---GTATVAPDDL-QAPYMSML--- 110 Pseudoalteromon...
Q6KI89         6 LYQANTFATIQNKHYKGDMSLLEVLKKGKFGVGTFNYTDGEFILKDGIPYLADTN---MNLVKPSEKL-FLPLYSVG--- 78  Mycoplasma mobile
BAK60301       4 IFQHGSFNTLYGGFYEGTITAGEALKYGQIGIGTLDGADGEVIILDGTAYHGNSE---NQVRVVKPNE-TLPYVAVI--- 76  Lactococcus gar...
Q03XL2         4 IYQHGTLELIMSGLYDGTAPLSSILNHGSSGIGTMDELDGEVTIIENSVYQTKAN---GVTKGITDLSlETPFTSIHsqs 80  Leuconostoc mes...
Q8DZB8         7 LFQYSTLSSLMAGLYKGSLTIGELLTHGDLGIGTVHMIDGELIVLDGKAYQAIGTdgkAEIIQLSDDV-TVPYAAVL--- 82  Streptococcus a...
P95676         7 LFQYNTLGALMAGLYEGTMTIGELLKHGDLGIGTLDSVDGELIVLDGKAYQAKGD---KTIVELTDDI-KVPYAAVV--- 79  Lactococcus lac...
Q8DTA7         6 LFQYNTLGALMAGLYDGSLTVGELLEYGDLGLGTLDSIDGELIVLDGKAYQAKGSgdkPEVVEVPDDM-KVPYAAVI--- 81  Streptococcus m...
WP_004257238   3 LFQHNTLAALMSGLYEGTLTIGELLKKGDFGIGTLSGINGELIVLDGKAYIATGD---KKVRQVEDSE-TVPYAAVA--- 75  Lactococcus gar...
5XNE_A        77 ---FFTPD-MTHKIDAKMTREDFEKEINSMLPSRNLFYAIRIDGLFKKVQTRTVEL-QEKPYVPMVEAVKT-QPIFNFDN 150 Bacillus subtil...
CAZ98613     127 ---NFQPK-KTVTIENITSYEDLSKELQKYATSINSFYAYRIKGEFGYLKMASAHK-VENEDVSLFDYLDT-RVMYTREN 200 Zobellia galact...
Q15PC6       111 ---KFEPT-KTITLKNIRSFKELQDAITSQITSVNSFYAFKAKGRFDYAHLASAHG-VEDEDVDFFEYLAS-RQMYDLTN 184 Pseudoalteromon...
Q6KI89        79 ---DINNSqKSYKLSSSMKMKDFLLFLENQLNLKNYPALLNIEVSLESALLRSIKK-QEEPFLNFIDSLKKyEVRKELKN 154 Mycoplasma mobile
BAK60301      77 ---DHQPF-ATYKVNGLTMQT--LHDLTEKFPTRNTAYSLKMTGHFDSVEISSKPAkNTKNY---LEILAE-QPHFTEKN 146 Lactococcus gar...
Q03XL2        81 elyYFLQE-------KFLTFDSLNNISKQHQSWANLPASIQINASFSKLKVRVAPK-QMKPYPPFVDVTLK-QPVFNYEN 151 Leuconostoc mes...
Q8DZB8        83 ---PHHIQ-KQFDINAEIDNKDLEEMILKNFEGQNLFKSLKIKGTFSRMHVRMIPK--SPQHKRFADIASN-QPEFTREN 155 Streptococcus a...
P95676        80 ---PHQAE-VVFKQKFTASDKELEDRIESYFDGQNLFRSIKITGEFPKMHVRMIPR--AKSGTRFVEVSQN-QPEYTEEN 152 Lactococcus lac...
Q8DTA7        82 ---HHEAE-VIFKQRFEMTDKELQERIESYYDGENLFRSIKIHGTFAKMHVRMIPR--STPDEKFAEVATH-QPEYRAEN 154 Streptococcus m...
WP_004257238  76 ---HHDAT-LSFQQEEKIASEELFEKIENEFNSENTFYTIKMTGDFDMMHVRMAPG--AAEGEPFAKVAEN-QPEYKEHQ 148 Lactococcus gar...
5XNE_A       151 VRGTIVGFLTPAYANGIAVSGYHLHFIDEGRNSGGHVFDYVL-EDCTVTISQKMNMNLRLP-NTADFFNANLD 221 Bacillus subtilis subs...
CAZ98613     201 IKGTLVGLFTPDYIGNVVIPGMHFHFLSEDITLGGHLEDIKF-DKLQVEIQEINQVNLQLP-QTEKFRNKTLK 271 Zobellia galactanivorans
Q15PC6       185 TTGTVVGIYTPEYLGDISIPGLHFHFQNGNNTVGGHLEDIRF-NSMDFEMQEFDKINLVLP-NGPKFRSKKMQ 255 Pseudoalteromonas atla...
Q6KI89       155 LEGSLIGVWYPKHLQPINNSGFHFHFIDKTNKIGGHLLDFEIkPNIKIAFEEKTNLVVEFS-ENEDLKnltii 226 Mycoplasma mobile
BAK60301     147 ISGTIVGIWSPKFLEDLYGDGAHLHFLSDDKTFGGHLTEF-LsGQITIEVGQVGEMKQEFPqENENFKAMRfe 218 Lactococcus garvieae Lg2
Q03XL2       152 VSGTLIGDFGPDLYSGIMASGWHLHFLSDDRTIGGHVLDFKA-SDVLGRIDLFNELNIALPtDNPDFNNHEAD 223 Leuconostoc mesenteroi...
Q8DZB8       156 VSGTLVGIWTPELFHGVGVKGFHVHFISDDLTFGGHVMDYSL-TQGKVEIGKVDQLDQCFPtQDQEFLKANFD 227 Streptococcus agalacti...
P95676       153 VKGTIVGIWTPEMFHGVSVAGYHLHFISEDFTFGGHVLDFII-DNGTVEIGAIDQLNQSFPvQDRKFLFADLD 224 Lactococcus lactis sub...
Q8DTA7       155 ITGTIVGIWTPEIFHGVSVAGYHLHFISDDHTFGGHVMDYVI-SEGQVEVGAVDQLDQRFPvQDRQYLFAKFN 226 Streptococcus mutans
WP_004257238 149 VVGTIVGFWTPEMFHGVSVAGYHLHFLADSCNFGGHILGFTG-FSGKVEIGQVDALEQNFPtKSQNFLQAKFN 220 Lactococcus garvieae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap