Conserved Protein Domain Family
Stanniocalcin

?
pfam03298: Stanniocalcin 
Stanniocalcin family
Statistics
?
PSSM-Id: 397405
Aligned: 8 rows
Threshold Bit Score: 319.802
Threshold Setting Gi: 47216825
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAG10147       8 ALLVFSVLEQVsgsdnaeiYESLPEKP--VTQKGRLSLQNTAEIQHCLVSAGDVGCGVFECFENNSCEIRGLQEICMTFL 85  spotted green p...
XP_006625371   7 ILLLLVLLTSA--------YELDQNESf-SPRRTRVSTHSPSDVARCLNSALQVGCGAFACLENSTCDTDGMHDICKSFL 77  spotted gar
XP_007241438   8 LLFLVLAVTAQg------dYEP-------ALRQTRFIASTPSEVTRCLSSALQVGCSAFACLESSTCDTDGMHDICNIFL 74  Mexican tetra
Q6PHV3         7 FLLLVVLAACA--------FCTTQEST--QPRRARFSSNTPSDVARCLNGALQVGCATFACLENSTCDTDGMHEICNVFL 76  zebrafish
XP_543238      7 VLLV-LVISASa------tHEAEQNDSv-SPRKSRVAAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFL 78  dog
XP_414534     14 LLLLLARAAAAagteatrpPEGQPERT--PQQKGRLSLQNTAEIQHCLVNAGDVGCGVFECFENNSCEIRGLHEICMTFL 91  chicken
ELK17387      12 LALVWATFDLArgtdatspPEGFQDRS--SQQKGRLSLQNTAEIQHCLVNAGDVGCGVFECFENNSCEIRGLHGICMTFL 89  black flying fox
XP_002932600   7 LLLLPLLLSASa------sYDSEPNDSqlGSRKGRLAPHSSVEVVRCLNGALQVGCGAFACLENSTCDTDGLYDICKAFL 80  tropical clawed...
CAG10147      86 HNAGKFDSQGKSFIKDALKCMAHGLRHKFSCISRKCTSIKEMVFQLQRECYMKHNLCSAAKENVAVMVEMIHFQDLFPKG 165 spotted green p...
XP_006625371  78 YSAAKFDTQGKVFVKESLKCIANGITSKVFLTIRRCSTFQRMISEVQEECYSKLDICGVAKLNPDAISEVAQLPSHFPNR 157 spotted gar
XP_007241438  75 NSAAVLNTEGKTFVKESIKCIAKGITSKVHQTIRRCAAFQNMITEVQEECYSKLGICGVARSNPDAIGEVVKVPKHFPNR 154 Mexican tetra
Q6PHV3        77 HTAAVFNTEGKTFVKESIKCMANGITSKVFQTIKRCSTFQKMIAEVQEECYKKLDLCEVARSNPEAIGDVVQVPNTFPNR 156 zebrafish
XP_543238     79 YSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSVAKRNPEAITEVVQLPNHFSNR 158 dog
XP_414534     92 HNAGKFDAQGKSFIKDALKCKAHALRHKFSCISRKCPAIKEMVFQLQRECYLKHDLCSAAKENVQVIVEMIHFKDLLQHE 171 chicken
ELK17387      90 HNAGKFDAQGKSFIKEALKCKAHALRHRFGCISRKCPAIKEMVFQLQRECYLRHNVCSAAQENTRVMVEMIHFKDLLLQE 169 black flying fox
XP_002932600  81 YSAAKFDTQGKVFVKESLKCIANGITSKVFLSVRRCSSLQRMISEVQQDCYTKLDICTVAQYNPSAITEVVHLPQHFSNR 160 tropical clawed...
CAG10147     166 PYVELVNILLSCGEEVKEALTRSVRLQCEQNWGALCDSLSL--CSSLS 211 spotted green pufferfish
XP_006625371 158 YYSKLLQSLMECDDETVSLVRSSLVSRLGPEMAMLFQLLQSkpCPSSS 205 spotted gar
XP_007241438 155 YYSTLLQSLMECDEDTVGVVRSGLVAKLGPDMDTLFQLLQKkpCSADg 202 Mexican tetra
Q6PHV3       157 YYSTLLQSLMECEEDTVEVVRAGLVSRLGPDMATLFQLLQNkpCSSEP 204 zebrafish
XP_543238    159 YYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTdhCAQTH 206 dog
XP_414534    172 PYVDLVNILLTCGEEVKKAITRSVQAQCEQNWGSLCSILSF--CTSSM 217 chicken
ELK17387     170 PYMDLVNLLLTCGEDVREAITHSVQTQCEQSWGSLCSILSF--CTSAV 215 black flying fox
XP_002932600 161 YYNTLLRSLLDCDEETVSAVRSNLMEQIGPNLASLFQVLHGdkCSHIQ 208 tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap