6RFL


Conserved Protein Domain Family
Pox_Rap94

?
pfam03294: Pox_Rap94 
RNA polymerase-associated transcription specificity factor, Rap94
Statistics
?
PSSM-Id: 397403
Aligned: 10 rows
Threshold Bit Score: 646.411
Threshold Setting Gi: 81970562
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6RFL_I   1 MDSKETILIEIIPKIKAYLLDANISPK-SYDDFISRNKNIFVINLYNVSTITEEDIRLLYTTIEQNIDADDQTLVAIFSY 79 
P68438   1 MDSKETILIEIIPKIKAYLLDANISPK-SYDDFISRNKNIFVINLYNVSTITEEDIRLLYTTIEQNIDADDQTLVAIFSY 79  Vaccinia virus WR
Q6TUU0   1 MESKETVLIDIIPKIKSYLLS-ETDTK-SYSDFITKNKNIFVVNLYNVSTITEEDIRLLYATIEQNIDVDDQTLISIFSY 78  Yaba monkey tumor virus
Q08FR8   1 METKESVLIDIIPKIKDYLLNPNTGPK-SYNDFISNNKNIFIINLYNISTITEEDIRLLYATIEQNIDVDDQTLISIFSY 79  Deerpox virus W-848-83
Q9Q8M8   1 MDSKESVLIEIIQKIKAYLLDPNIASK-SYADFISNNKTIFIVNLYNVSTVTEEDIKLLYATIEQNMDVDDQTLISIFSY 79  Myxoma virus
Q98252   1 MNTKESVLLEIIPKIRAYLRE-GAGEK-SYSDFISRNKSIFVCNLYNVNALTDDDVRLLYLTIEQNMDADDQALVSIFSY 78  Molluscum contagiosum...
Q9J589   1 MENKESVLLELVPKIKAYIKDDTVKEK-SYQDFIEKNKELFICNLYNVNMITDEDIKLLYITIEQNIDIDDKSLVAIFSY 79  Fowlpox virus strain ...
Q070E7   2 eNNKEIMLLDVIKKIKRYLADDSVKEK-SYADFIAENKNIFIYNLYNVNVVTEDDIKLLYITIQQNPDIDDPSLVSIFSY 80  Crocodilepox virus
Q9EMZ5   1 MDQIE--IIKTINSMIEYIK--NTKDKlSIDNFIFEHKDLYDNVVIYSKYLSDKDFKFLYVIVEKYPDANPNIIYNIFK- 75  Amsacta moorei entomo...
Q6TVR0   1 MDSRESILASIVPKIRAYMRDPNTATK-SYTDFIADNKSIFVVNLYNVDAITEDDIRLLFATMEQNPDADDATLISIFSY 79  Orf virus
6RFL_I  80 IGYKFEQAVKEEISTSLSFNDKn-TTDEMTYNLYDLFFNTLDMYLRQ---KKISILVNDDVR-GD-----VIVSYKNSDL 149
P68438  80 IGYKFEQAVKEEISTSLSFNDKn-TTDEMTYNLYDLFFNTLDMYLRQ---KKISILVNDDVR-GD-----VIVSYKNSDL 149 Vaccinia virus WR
Q6TUU0  79 IGYKFEQNIKEEVSSSLFINESs-ATDEMTFNLYNMFFNTLDMYLRQ---KRINVLVNDESN-SD-----ISINYRTSDI 148 Yaba monkey tumor virus
Q08FR8  80 IGYKFEQNIKEEITSSLFIHEQnsTTDEMTFNLYNLFFNNLDMYLKQ---RRINVLVNDELN-GD-----ITVNYRTSDL 150 Deerpox virus W-848-83
Q9Q8M8  80 VGYKFEQQINEEIASSLFIQEQsvNTDEMTFNTYNLVFNTLDMYLRQ---RRVNVLVNDDLN-GD-----ITINYRTSDI 150 Myxoma virus
Q98252  79 IGYKFERSVQEDAGESAGAGAQ--ITDDMTYNLYDLFFSTLDMYVRQ---RRVSVLVNDDAH-ND-----VAIPRHTSDL 147 Molluscum contagiosum...
Q9J589  80 IGYNFEKNIHDD-NSSIDLGDR--MTGDMNYNMYDTFFSTLDFIIRQ---KHVNILVNDEGN-ND-----FNINYRSFTT 147 Fowlpox virus strain ...
Q070E7  81 IGYKFKRTINERQPDDAPVAT---ANDEFRHNFFSFFFTYLEFYAKL---KTMRVLVNRENEpGD-----ANVNYRTSEL 149 Crocodilepox virus
Q9EMZ5  76 --TS-QISITQDININKIIQNKdnTKINQDIHTYNYLLLLNKLYIFQpipKFINILWDIKSKnVDnldkiNNINTNSLNI 152 Amsacta moorei entomo...
Q6TVR0  80 IGYKFEKQVRDDATASLSVGER--IADDTRHSMYEMFFNTFDMVIRQ---RRVNVLVHDDAT-GE-----AVVVQRTSDL 148 Orf virus
6RFL_I 150 VSSF-NAELEPEIKKIPFNMKNLLPYLEKNLDQLRFSKKYLDFAYLCRHIGIPISKKKYNVRYVFLYKIDGLSIPIIIKD 228
P68438 150 VSSF-NAELEPEIKKIPFNMKNLLPYLEKNLDQLRFSKKYLDFAYLCRHIGIPISKKKYNVRYVFLYKIDGLSIPIIIKD 228 Vaccinia virus WR
Q6TUU0 149 ASVF-DSNTEPEIREIPFNMKYMIQYVSKNIDRLRFSKKYLDFAYLCRHIGIPISKKKLNMRYIYLYKVDGLSIPIVIKD 227 Yaba monkey tumor virus
Q08FR8 151 TSEF-DTNVDPEVREIPFNMKDMISYVSKNLDQFRFSKKYLDFAYLCRHIGIPISKRKLNMRYIYLYKVDGVTIPIVIKD 229 Deerpox virus W-848-83
Q9Q8M8 151 ASNF-EPSKEPEVREIPFNMKDMISYVSKNIDQFRFSKKYLDFAYLCRHIGIPISKRKLNMRYIYLYNVDGVSIPIVIRD 229 Myxoma virus
Q98252 148 RSSF-DAAREPEVREIPFNMRDLLPYVAKNLDQLRFSKKYLEFAYLCRNIGIPISKRKFNVRYVYLLRVDDLQIPVVIKD 226 Molluscum contagiosum...
Q9J589 148 SLSYkEDKYEQVVNEIPFNMKELLSYVSKNLDQLRFSKKYLDFAYLCRNIGIKISKRKYNVRYIFNYVIDELTIPIVIKD 227 Fowlpox virus strain ...
Q070E7 150 VSSF--PEQPTRVVEVPFNMREIISYVSKNIDQLQFSKKYLDFCYLCRIIGVRISKKKFNLTYVIEYSVDNVVIPICVTD 227 Crocodilepox virus
Q9EMZ5 153 ITNI----EMSKVNIIYISFTYISSYIESHKSELTLNKKFSIYDNLRRIIGVPISNNNYKLNYYIKAKIDSETLIYNIFN 228 Amsacta moorei entomo...
Q6TVR0 149 RTAF-DDAAEPAVREIPFNMRNMLPYVSKNLDRIRFSKKYLEFAYLCRHIGIPVSRRKLNLRYVFMYELDGARIPIVIRD 227 Orf virus
6RFL_I 229 FLDVKYVYLENTGKIYKNSFSEDhNNSLSDWGKVIIPLL---KDRHLYSYIFLSSYHL-----------------HSYYT 288
P68438 229 FLDVKYVYLENTGKIYKNSFSEDhNNSLSDWGKVIIPLL---KDRHLYSYIFLSSYHL-----------------HSYYT 288 Vaccinia virus WR
Q6TUU0 228 FLDVKYVYLEETGKTYKNSFSEDkNNSLIDWGKVIIPKL---KNKYLYSYIFLSNHYL-----------------KDLFP 287 Yaba monkey tumor virus
Q08FR8 230 FLDVKYVYLEETNKTYKNSFSEDhNNSLMDWGKLIIPKL---KNKYLYSYIFLSNYYL-----------------RDLFL 289 Deerpox virus W-848-83
Q9Q8M8 230 FLDVKYVYLEETGKTYKNSFSE--NNSLLEWGKLIIPKL---KNKHLYSYIFLSNYYL-----------------RDLFP 287 Myxoma virus
Q98252 227 YLDVKFVYLRETGKVYRNRFSDErNDSLLEWGRLLIPRL---QNRALYSYLFLSSYHL-----------------CDLFL 286 Molluscum contagiosum...
Q9J589 228 YLDVKYVYLEETNKAYRNNFDND-NKYFYEWGKVIIPKF---KNPRLYSYFFLSNYGL-----------------CDLFM 286 Fowlpox virus strain ...
Q070E7 228 YLDVKYVELKETGARYRNTFQMEnNPNLAVWGQLVIPRL---ANGTLYSSFFLSSVDL-----------------AQFFT 287 Crocodilepox virus
Q9EMZ5 229 SVAFKKVIIYGFGVYQIKDVKNIiKDTINDVSSYIVNN----NKEKLYQRTYCCCYFLncyyekifknlstqtydKILYS 304 Amsacta moorei entomo...
Q6TVR0 228 FLDVKKVFLAATDKVYPNNFAEE-QPAVAEWGRAFVDAMaadARRLLYKYVFLSSRHL-----------------CDLFP 289 Orf virus
6RFL_I 289 DLIARDEPVF-VKRKK-LDIIeIDEPEAWKRDVRVEFAPCEHQIRLKEAMK-VDANYFTKINNFANEFIYYEDGVAYCRV 365
P68438 289 DLIARDEPVF-VKRKK-LDIIeIDEPEAWKRDVRVEFAPCEHQIRLKEAMK-VDANYFTKINNFANEFIYYEDGVAYCRV 365 Vaccinia virus WR
Q6TUU0 288 DLIHEKEIFF-RDCKQ-TNKIeVHEPSSWKDDVTIKTLPCEHQIKLIDAMK-IDIDYFNKINNFAREYVYYEDGLAYCNV 364 Yaba monkey tumor virus
Q08FR8 290 ELINEKDAVF-KDGKK-LDKIeIYEPKSWREEVQIESIPCEHQIKLIETMK-IDTEYFNKINNFANEFIYYEDGVAYCKI 366 Deerpox virus W-848-83
Q9Q8M8 288 ELIKEKDAVF-NQLDD-VKKIeIAEPAGWREDVIIKYIPCEHQIALEEALK-PDTEYFSKVNAFAKEYIYYEVGVAYCKL 364 Myxoma virus
Q98252 287 ELRELGSASF-RAAPA-RSRVpVAEPRAWRAAVSVEVQPCEHQVRLAEALR-VDLDYYSKVNRFATEFLEYEDGLAYCVL 363 Molluscum contagiosum...
Q9J589 287 ELINIKQVTF-EPRKNpIEYIyVSELKFWEEGGSVDFVPCEHEIAIIDAKK-VSLEYYENINKFIAKYIYYEDGLAYCNL 364 Fowlpox virus strain ...
Q070E7 288 RLVVRPDAEFvERAAApLREIvVREPAFWRETQEIAFRVCEHQVKMDDIFRnVSVNYFEQVNAFINDMIYYEDGLAYCSY 367 Crocodilepox virus
Q9EMZ5 305 NVVNINDVIH----------------------KKYEYFECQHVQEYKNVFKnVE-NFYINTNKFLENYINIVNKVAICKI 361 Amsacta moorei entomo...
Q6TVR0 290 ALLNARDAKF-RPASR-AALV-VREPPGWGEGVRFESPPCEHQIRLAVAMR-VDVDYFAKINEFVEEFVYFEDGMAYCRI 365 Orf virus
6RFL_I 366 CGINIPIFNLDAADViKNT-VIVSTFNK-TIFLSEPYSYFVHSQRFIFNIIMSFDNIMKSQTWVMKYNINRLILNFLIDI 443
P68438 366 CGINIPIFNLDAADViKNT-VIVSTFNK-TIFLSEPYSYFVHSQRFIFNIIMSFDNIMKSQTWVMKYNINRLILNFLIDI 443 Vaccinia virus WR
Q6TUU0 365 CGMNVPTFNLDAADViKNN-VVVSTFNK-SIFLSEPYSYFVHSQRFIFNIIMSFDNIMKSQTWVMKYNINRLILNFLIDI 442 Yaba monkey tumor virus
Q08FR8 367 CGINVPNFNLDAVDViKNN-VIVSTYNK-SIFLSEPYSYFVHSQRFIFNIIMSFDNIMKSQTWVMKYNINRIILNFLIDI 444 Deerpox virus W-848-83
Q9Q8M8 365 CGMNIPKFNLDATDViKNN-VLLATFNK-SIFLSEPYSYFVHSQRFIFNIIMSFDNIMKSQTWSMKYNINRIILNFLMDI 442 Myxoma virus
Q98252 364 CGMNVPVFNVGAADVtKSS-VLVSTYSK-SIFLSEPYNYFVHSQRFIFNIIMSFDTIMKAQTWAMKYNINRLILNFLISI 441 Molluscum contagiosum...
Q9J589 365 CGINIQELNLDATDVtKIS-LINVTYNK-SIFMSEPYNYFSHSQRFIFNTIMSFDTIMKSQMWNMKYNINRLILNFLIDI 442 Fowlpox virus strain ...
Q070E7 368 CHVHVPVFDQGVGNVaKDK-VVAVNYNKkNIFNAEPYSYFVQSQRFIFNIIMSFDAVMKAQTWSMKYNINRMLIDFLIHI 446 Crocodilepox virus
Q9EMZ5 362 CGESLDMFNFEEANYiQSKgEIIITTNKeNIFQYETYSRLVNAELFLTDIIGIYDDIFNTNRMDDFNNISRIIIDFFIDI 441 Amsacta moorei entomo...
Q6TVR0 366 CGMNIPDLNTDASGA-RAG-VVVPATNK-SIFLSEPYSYFSHSQRFIFNIVMSFDTIMKTQTWAVKYNINRLILNFLIAI 442 Orf virus
6RFL_I 444 NSRRQEYEKKFSSEIKRG-LFFLRLSANLFESQVSSTELFYVSKMLNLNYIVALVIILNSSADFIVSYMTSKNK------ 516
P68438 444 NSRRQEYEKKFSSEIKRG-LFFLRLSANLFESQVSSTELFYVSKMLNLNYIVALVIILNSSADFIVSYMTSKNK------ 516 Vaccinia virus WR
Q6TUU0 443 NSKRQKYEKKFNDEIKKG-VFFLRLSANLFDIHVSSTELFYSSKILNLNYIVVLVIVLNSSADFIISYMNAKKK------ 515 Yaba monkey tumor virus
Q08FR8 445 NSKRQKYEKRFLNEIKKG-VFFLRLSANLFDIHVSSTELFYSSKILNLNYIVVLVILLNSSADFIVSYMSAKKK------ 517 Deerpox virus W-848-83
Q9Q8M8 443 NAKRQKYEKTFADEIKKG-VFFLRLSANLFDIHMSSTELFYSSKMLNLNYIVVLVIILNNSADFILSYMASKKK------ 515 Myxoma virus
Q98252 442 NNRRQEYEKRFAAEIKRG-IFFLRLAANLFDIHVSSMELFYSAKILNLNFLVVLVIVLNSSADFIMSYMAGKKR------ 514 Molluscum contagiosum...
Q9J589 443 NSKRHEYEKQFATEIKKG-IFFLRLSANLFDIQMSSMELFYSAKILNIHFIVALVIVLNSGADFIMYYMTNKKE------ 515 Fowlpox virus strain ...
Q070E7 447 NDKRHFYEKQFAKEIKNG-IFFLRLSANLFDIRMSSTELFYTAKILNLNYIIALTITLNSSANFFLGYLKSKQIfp---- 521 Crocodilepox virus
Q9EMZ5 442 NTNRLEYQDKYKKQISNSkLFFIRLSNNLFIAVYNEKEQYAEERQLNMFIIFGISLLLLSNFNELIGIIKNNKKlktifd 521 Amsacta moorei entomo...
Q6TVR0 443 NARRQEYERRFAAEIKRG-VFFLRLSANLLDVHASATELFQSAKTLNLNFIVALVIVLNSSADFLVSFMASRSAkktkda 521 Orf virus
6RFL_I 517 --TVEESTLKYAISVVIYDFLVKTRICEKGS-----LDTIVLFTDVYTSIMPEELDLHFQRITLELRK------------ 577
P68438 517 --TVEESTLKYAISVVIYDFLVKTRICEKGS-----LDTIVLFTDVYTSIMPEELDLHFQRITLELRK------------ 577 Vaccinia virus WR
Q6TUU0 516 --QIDETSIKYALSVIIYDFLLKTKICEKGF-----LNTITLLTDVYTSIMPEELNVHFNRILIELKK------------ 576 Yaba monkey tumor virus
Q08FR8 518 --EVDETTLKYSISVIIYDFLLKTKICEKGS-----LDTIILLTDVYTSIMPEELNAHLQRIIIELRK------------ 578 Deerpox virus W-848-83
Q9Q8M8 516 --PVTDASIKYAISTIIYDFLVKTKICEKGA-----LDTIILFTEVYTSIMPEELQLHLQRIIVEFEK------------ 576 Myxoma virus
Q98252 515 --ALSEDTLDQAIAVIIYDFLLKTRICEKNA-----LDTIVFFARVYMSIMPEELVAHHARIRAELRR------------ 575 Molluscum contagiosum...
Q9J589 516 --ETNYSDLNHIISVIVFDFLKKTRTVDSKQ-----FNTIELFTETYMKIATEELIVHYNRIKLEMER------------ 576 Fowlpox virus strain ...
Q070E7 522 etDTLEAQFNYYIAVIVNQFLVKTKVLDKSA-----VNHILFFTDVYASIMPDEMVAYYHRLRAEVAR------------ 584 Crocodilepox virus
Q9EMZ5 522 nqNDIKINLDNFIKDTVFIYISRNRLIDKKSrelinYDTII---DVYLNILTPELKSCYNIILNRLYKnidilkydyiel 598 Amsacta moorei entomo...
Q6TVR0 522 svEVTESTLRLSIATAVHHFLVKTRVCGKED-----FDTVMLLTEVYTSIMPDELEAHYRRLVAELHR------------ 584 Orf virus
6RFL_I 578 ----LVSIQRSALEPNYDVESRGEELPLSALKFFDTSTIIVKTM-APV-----HTCVEQKIVAPTPSVEPTDASLKNFKE 647
P68438 578 ----LVSIQRSALEPNYDVESRGEELPLSALKFFDTSTIIVKTM-APV-----HTYIEQKIVAPTPSVEPTDASLKNFKE 647 Vaccinia virus WR
Q6TUU0 577 ----LISIKRSEKQPSYDVEVKILDPPLTKIKFFNNCSIIVKTMtLPDi----KKKVNKNIERPTYTFKFNEKMFLQFKS 648 Yaba monkey tumor virus
Q08FR8 579 ----LMSIQRSIEPPNYDVEVKMLDPPLSFIKFFNNHTIIVKNM-VPLk---kAEIYTKNLIKPIPIADNTEESWNEFKK 650 Deerpox virus W-848-83
Q9Q8M8 577 ----LNSIQRSKSPPNYDVEVKTLDGPLAAIKFFDTYTIIVKHM-VPLt----CDCKPLPTTHPKELAADTKETWESFRR 647 Myxoma virus
Q98252 576 ----LISIQRSRRKPDYDVDNRAPVPALRP-RFFPLRATCTQFFpAPP-----PRAQGTGLVTPAEPVPATPEHVRRFEA 645 Molluscum contagiosum...
Q9J589 577 ----LIAIKKDRKTPNYDISIYRQIQRTDEIAFFPSCITSTKLF-ITYekvvaENTEIITIKHPVRIKEGTDEDKEIFED 651 Fowlpox virus strain ...
Q070E7 585 ----LLVVERAKNEKDYEVENTTEVAPLR-IRFFDARG---SAMpVAFahveeRSVATPSVLPSPDRPQDLEAAERDFAS 656 Crocodilepox virus
Q9EMZ5 599 pdipLLPVTLGYKHKNIDTGPTISFLPLEDV------------------------------------------------- 629 Amsacta moorei entomo...
Q6TVR0 585 ----LNTIGRTTRSRNYLVESYADAGEARAVEFFASQRVGARSMrTPPr---aRPTVCAEVARPAETPAESPDARAEFQD 657 Orf virus
6RFL_I 648 LTc-DeDIKILIRVHDTNATKLVI-FPSHLKIEIER------KKLIIPLKSLYITNTLKYYYSNSY-------------- 705
P68438 648 LTcdE-DIKILIRVHDTNATKLVI-FPSHLKIEIER------KKLIIPLKSLYITNTLKYYYSNSY-------------- 705 Vaccinia virus WR
Q6TUU0 649 LTtdE-ELKVLIRYNDTNATKLVI-FPTHLKIEIER------KKLIIALKTLFTNNVLKYYYSVPS-------------- 706 Yaba monkey tumor virus
Q08FR8 651 ITtdD-DLKVLIRYNDTNAIKLVI-FPTHLKIEIER------KKIIIALKNLFINNVLKYYYSIPS-------------- 708 Deerpox virus W-848-83
Q9Q8M8 648 LTtdD-ELKVLIRYNDTNATKLVI-FPTHLKIEIER------KKIIIAFNKLFINNVLKYYYSISS-------------- 705 Myxoma virus
Q98252 646 MTg-A-DTRVLIRVNDTNATNPVF-FTTHLKIEVEK------KKLIIPLKKLFVSNTLKYYSSTA--------------- 701 Molluscum contagiosum...
Q9J589 652 IMk-K-TTKVLIRVNDTNAYNASF-FTTHIKLEVEK------KKIIIPLTSLFVYNVLKYYSSNVD-------------- 708 Fowlpox virus strain ...
Q070E7 657 MSidN----VLIKLNNTAIETIEI-FSTYVKVILEK------KQTIISIQRLFLYRLLTYFSGPE--------------- 710 Crocodilepox virus
Q9EMZ5 630 -----------INYNNVNIYESNIrYITYDTLKIKNlsdfdiKDINVELKTIIERFNSEYYYRNISilnfeqmdnynfyi 698 Amsacta moorei entomo...
Q6TVR0 658 IM--S-DSRVLIRVHDTNAYNMKR-FEDHIKIEIEK------KKIIISLASLFVTNTMKYYYANPA-------------- 713 Orf virus
6RFL_I 706 -------LY-------------------VFRFGDPMPFEEELIDHEHVQYKINCYNILRYHLLPDSD-VFVYFSNSLNRE 758
P68438 706 -------LY-------------------VFRFGDPMPFEEELIDHEHVQYKINCYNILRYHLLPDSD-VFVYFSNSLNRE 758 Vaccinia virus WR
Q6TUU0 707 -------LY-------------------VFRFGDPFPFDDELIDFFHVQHKVNCYNLLRYYMLPNSD-VFVYFNKSLKRE 759 Yaba monkey tumor virus
Q08FR8 709 -------LY-------------------VFRFGDPFPFDDELIDHNHVQHKINCYNLLRYHLLPDSD-VFVYFNKSLNRD 761 Deerpox virus W-848-83
Q9Q8M8 706 -------LY-------------------VFRFGDPFPFDDDLIDPTHVQIKVNCYNLLRYYLLPDSD-VFVYFSDSLKRS 758 Myxoma virus
Q98252 702 -------FY-------------------VFKFGDPFPFDSELIDAEHVQYKVNGYNLLRHALLPRSE-LFVYFGSSLHRH 754 Molluscum contagiosum...
Q9J589 709 -------FY-------------------VFKFGDPFPFHYDLISQEHTNHKITGYNMLRQELLPNSN-VFTYFSDSLNRQ 761 Fowlpox virus strain ...
Q070E7 711 -------FY-------------------VFKFGDPFPFNQTLVNVHHLNRKIDCYNFLVRSLLPDSD-IFFYHSRDLNRH 763 Crocodilepox virus
Q9EMZ5 699 digqkyfFYindvlsnsniviksniyskIMNFGDSLPFLNKIYKF-HYTLLFDNLNLLINFLYPNVKiIFNYDQDYITRD 777 Amsacta moorei entomo...
Q6TVR0 714 -------MY-------------------VFRFSDPYPFDETLLSAEHVAHKVNGYNMFRRSFFPDSD-VFVYFSDSLSRV 766 Orf virus
6RFL_I 759 ALEYAFYIFLSKYV--NVKQWIDENITRIKELYMINFNN 795
P68438 759 ALEYAFYIFLSKYV--NVKQWIDENITRIKELYMINFNN 795 Vaccinia virus WR
Q6TUU0 760 KLEYSFYMFLHNYVg-DVSSWIDKNITRIRELYVINFNN 797 Yaba monkey tumor virus
Q08FR8 762 ELEYTFFRFLSKYVn-NVSEWIDENITRIRELYLFNFNN 799 Deerpox virus W-848-83
Q9Q8M8 759 DLEYTFYRFLLKYVh-DVPAWIDKNITRIRELYFFNFNN 796 Myxoma virus
Q98252 755 ELELAFYMFLCNYV--DVQQWMDENTSLIRDLYLINFNN 791 Molluscum contagiosum virus subtype 1
Q9J589 762 ELEFSFYMFLASYV--NVTEWIEENSKKIKELYIINFNN 798 Fowlpox virus strain NVSL
Q070E7 764 RLEFGFYLFLSKFV--KVKKWIEQNKEKIKLLYLVNFNN 800 Crocodilepox virus
Q9EMZ5 778 YFHYIVYNILISLIntNILSWIDVNKDIISKLYDNTLRF 816 Amsacta moorei entomopoxvirus
Q6TVR0 767 DLEFAFFLFLAGIVg-SVKDWIAESIAAIKELYMINFNN 804 Orf virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap