3FF0


Conserved Protein Domain Family
PHZA_PHZB

?
pfam03284: PHZA_PHZB 
Click on image for an interactive view with Cn3D
Phenazine biosynthesis protein A/B
Statistics
?
PSSM-Id: 397400
Aligned: 3 rows
Threshold Bit Score: 302.192
Threshold Setting Gi: 502210509
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3FF0_B        11 FEDAVELRRKNRETVVKYXNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVF 90  Pseudomonas aer...
WP_012733720  13 NHAHAAVRQHNRKIVEQYMHTRGEARLKRHLLFTEDGVGGLWTTDSGQPIAIRGREKLGEHAVWSLQCFPDWVWTDIQIF 92  Burkholderia gl...
Q9I2J9        10 FTDNLELRRRNRATVEHYMRMKGAERLQRHSLFVEDGCAGNWTTESGEPLVFRGHESLRRLAEWLERCFPDWEWHNVRIF 89  Pseudomonas aer...
3FF0_B        91 ETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFXNVFQQLRALSIPVPQIKREGIPT 163 Pseudomonas aeruginosa
WP_012733720  93 ETQDPNWFWVECRGEGAIIFPGYPQGHYRNHFLHSFRFENGLIKEQREFMNPCEQFRSLGIEVPEVRRDGLPS 165 Burkholderia glumae
Q9I2J9        90 ETEDPNHFWVECDGRGKALVPGYPQGYCENHYIHSFELENGRIKRNREFMNPMQKLRALGIAVPQIKRDGIPT 162 Pseudomonas aeruginosa...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap