2ES4


Conserved Protein Domain Family
Lipase_chap

?
pfam03280: Lipase_chap 
Proteobacterial lipase chaperone protein
Statistics
?
PSSM-Id: 397397
Aligned: 42 rows
Threshold Bit Score: 96.2088
Threshold Setting Gi: 390609719
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2ES4_D               128 VWRRYRAYFDALAQLPGDGAVLGDKLd----pAAMQLALDQRAALADRTLG-EWAEPFFGDEQRRQRHDLERIRI-ANDT 201
CCU73744              99 VLSAYLGYLDALAAYDETTALKNQMSda---sSRMLTRLEWQQRLRREWLQpDVVTAFFTADELIDNYTLQKLAL----- 170 Thalass...
jgi:Dole_0359        136 TYQRYLDCEMAVADLAARFGPITTT-------ESGLELLREVQEFRRDFLGtELADRLFGEQVKEKEYSLRRAAI-VSDP 207 Desulfo...
WP_012174938         143 lyESYLTCELELSEMLADRPEPKTA-------AEVVRLLAEAQQFRREYLGaDVADALFGADIKTREYALRRSAV-AGDT 214 Desulfo...
instpast:LEPBI_I0885 134 LLTNYLKYEEAMVQLDPSSKS-----------YTNAERYEQIKQLRRKYFSkEDAELIFGLEEATADFSFNRKNFlDETK 202 Leptosp...
Q2SEF7               141 LLNDYISYQERIGELMAAPLAPTESQdyeyyaSVMANTFEQLKSLRRQIFApDVVDAFFGLDEAYSDYALAVMQV-KADA 219 Hahella...
jgi:Pmen_1764        135 LLGDYLDYKRASMALMQQPLDAHQQVdpqaqlQVLQAAFERLDALRRAHFSaAAQEALFGAEQAYARYTLDSLTL-QQRD 213 Pseudom...
CAV25538              96 LFAKYLEYKAALTALDVQFDNTSISA------EDLRALNQALLDLQAQFFSeSEISILFTHDNRMREIALEKLLL--KQE 167 Vibrio ...
Q6LFX4               108 LFQQYIDYKAALFALERTTSNGAASVn-----SQLSAMHQQLLEIQQQFFTpEQQQALFGEENQLRELALKQQEL--KHQ 180 Photoba...
WP_022561646          90 eFDKFIEYKLALNELA-PTDYQVLDL------NALQDLHTKVLDVQAEYFDeLERDNYFAEENLIREMALEKLRL--QQQ 160 Vibrio ...
2ES4_D               202 TLSPEQKAARLAALDAQL-------------TPDERAQQAALHAQQDAVTKIADL-QKAG-ATPDQMR---AQI-AQTLG 262
CCU73744             171 -LRNGANATELKQLDESL-------------PEVVQVMREQSQSVLTLNQEMAQM-QAQN-VSAEDQY---AWQ-VREYG 230 Thalass...
jgi:Dole_0359        208 DLYAEEKQAAMDRLTQEMwgeaagteislqpPTAYA---RYQDALAIYQKDLDEI------AEEDDRRaaiEDIrNRYLP 278 Desulfo...
WP_012174938         215 HLYGQEKEARIDRLTEEMwgdqaqaindysqP-----FHRYREKLQVYARDMAEM------ETDTQREemvKAFrNRYFS 283 Desulfo...
instpast:LEPBI_I0885 203 HLKAEERIRLYEDYRKKSfgpyyn-avasrePQYDK-------FETEMDLRQAELsKLSGtERDSKER---EVR-IRYFG 270 Leptosp...
Q2SEF7               220 QLSDSEKASQVEALRQKL-------------PAQMRDAHRQAAQRENLTREARRM-YREG-YDADSVR---QAL-RGQFS 280 Hahella...
jgi:Pmen_1764        214 DLDDSQRAQLQEQARERL-------------PEALRASEQRQQLALEQLARSEQL-WREG-ADEQQVR---EFL-AMIYD 274 Pseudom...
CAV25538             168 GLDESEYQQRLESYLSEQ-------------PDYVQ-------ASHQNQVSLQQL-SSSKgLDEQGLY---LKR-NELVG 222 Vibrio ...
Q6LFX4               181 AQSPADYQQLWQDEVNQL-------------PPNLQ-------ESYRNASLLNRL-ELTKdMDTQSQF---LIR-EELVG 235 Photoba...
WP_022561646         161 ATSASDFNHQWQQYLASK-------------PDYIQ-------RSDKNASLVEKL-NGLNnLSEQERH---LAR-ADLVG 215 Vibrio ...
2ES4_D               263 PEAAARAAQMQQDDEAWQTRYQAYAAERDRI--AAQGLAPQDRDARIAQLRQQTFTAPGE 320
CCU73744             231 EEAAQRLAQVKQRQEEWQQRLKDYRHYKQSP--ELQRLAPQDRDDLLQTYRDAHFTSLEQ 288 Thalassolituus oleivorans M...
jgi:Dole_0359        279 PDAVERINAMEQQQAEEQQAEEAYFAAEKGIa-EDTTLSEDQKAEQIESLRQEmlgdqag 337 Desulfococcus oleovorans Hxd3
WP_012174938         284 PEVVAQLEAIDVQMAQQQQADERFEQEKQQIl-ENDRLSQEEKDAALRALAMevygeqll 342 Desulfococcus oleovorans
instpast:LEPBI_I0885 271 KDGNERMEKVLREIKEEEETISKLEVEEKNLlkNNPNLSESEKEKKLMELRIKTLgskel 330 Leptospira biflexa serovar ...
Q2SEF7               281 DEKAEKIIAYYQREETWRARLDDYQRRKQDI--QAAARTDAETVAGLTQLRNSLFTSDEL 338 Hahella chejuensis KCTC 2396
jgi:Pmen_1764        275 PDTVQRLLVEQRRERDWQQRYQAYRRELAGL--QGRGLSTEDGEQLQRQLRERLFASEDR 332 Pseudomonas mendocina ymp
CAV25538             223 EEATQRLEALDQQRADFDGALDIYFVERNDIl-NDSALSEIEQKETIAQLRETHFQPQQL 281 Vibrio tasmaniensis LGP32
Q6LFX4               236 SEAAMRLTNLDRKRESFKQQIDEYLVEREKIl-QNENSNQYDKLLAVQTLRELTFESSQY 294 Photobacterium profundum
WP_022561646         216 EEAANRLADLDNQRAEFDSRIKSYLSQRDAI--NQATSSSEEKAQSIASLRNQSFSESEF 273 Vibrio nigripulchritudo
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap