3NJ2,3G7P


Conserved Protein Domain Family
DUF269

?
pfam03270: DUF269 
Click on image for an interactive view with Cn3D
Protein of unknown function, DUF269
Members of this family may be involved in nitrogen fixation, since they are found within nitrogen fixation operons.
Statistics
?
PSSM-Id: 397392
Aligned: 72 rows
Threshold Bit Score: 135.698
Threshold Setting Gi: 605575974
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3NJ2_B            53 YRTWTDELVI-APYVIPKKKRREISLEG---DIDPTT-KLRILCYFRAIAALIEKETGLLCQVVVDLNHEGFGWALVWGG 127 Crocosphaer...
jgi:PCC7424_2115  37 YQTWSNELLL-NSLIVSSGRTRKNPNSN---AVDSSLyYLRISAFYHTVAKEIEKKTGRLPQIFINLSPKGSSSALIFCG 112 Gloeothece ...
WP_013323686      36 YENWSNELLL-NSLILSPIREKNRAINS---QVDSSLsYLRVCAFYHTVAIEIEKKTGRLPETFINLSPQGSSSALICCG 111 Gloeothece ...
WP_012963774      28 WEKRGDEDLL-KEFLKGETNKPASFNFGghcAVDPKA-MLKIYAYFKALGVVIERRSNILTSTVINMDDEGNGNVIVYSG 105 Hydrogenoba...
Q9KJL5            35 YKSWSPELIL-KPYIVSKQEKRQISTDE---EVNPMT-LARIKLFYNAIATSIELETNEIMQVVVNINHEGFGWALVFCG 109 Trichodesmi...
WP_015156509      37 YRNWADELVI-KPYIVSKEAKRKISVEG---DVDPVT-KGRILSFYRAIAARIEQETGLLSQVVIDLSHEGFGWVLVFSG 111 blue-green ...
Q2JP91            30 YRAWSDELLL-KPFVVTKAQKRQISLEG---EVDPGV-RSRILIYYRAIAALIEKETGLLAQVVLDLNSEGFGWVLVFSG 104 Synechococc...
jgi:Thal_0428     31 WEKRKDEDIL-KEFL--KTSSKQIAHAGgscSLDPRA-MLKLHAYFKALGVIIERLSGYLTSAVINIDHEGNGTVILYAG 106 Thermocrini...
Q7MRG2            22 WNRLSDEELLgRLYIREKGASATCA------EVDEAT-TRNIKLYYQALAVAFEKRCGEMANVMMELNSEGYGRILVIVG 94  Wolinella s...
jgi:Dacet_1053    21 WKKIDDETIIsRHFVLSKEDKKKIDVYG---KMPDDV-VAKIRLFYEAVAQTVEWQTGKMAITVLDINTEGFGRALVVYE 96  Denitrovibr...
3NJ2_B           128 KLMVVSRSLRDAHRFGFDTLEKLNDQGTKLANAGIELVNKFPEVAR 173 Crocosphaera subtropica ATCC 51142
jgi:PCC7424_2115 113 NLLVVYDLLEKVSSFGFESLDKLVHTGEQLIHHAVARVHQFf---- 154 Gloeothece citriformis PCC 7424
WP_013323686     112 NLLVVYELLERVSSFGFDSLEKLINTGEQLIQYAVARVHQFf---- 153 Gloeothece verrucosa
WP_012963774     106 RLVLVNKTIRDANRFGFKSLEDMAKQGLKMIEKATQLLEKYEEVAR 151 Hydrogenobacter thermophilus
Q9KJL5           110 RLLVVARTLRDAQRFGFTSLEKMEDEGEKMAKAGIELAKKYKEVCK 155 Trichodesmium erythraeum IMS101
WP_015156509     112 RLLLVARTLRDAQRFGFDSLEKLTAEADKLVEKAIDLAQRYPEVGK 157 blue-green algae
Q2JP91           105 RLLLVVNTLRDAHRFGFDSLEQLSEKATALIDKGIQLARTYPEVGR 150 Synechococcus sp. JA-2-3B'a(2-13)
jgi:Thal_0428    107 RLILINKSIRDANNFGFKSTDNIKQEAEKLINKALQLIEKYEEVCK 152 Thermocrinis albus DSM 14484
Q7MRG2            95 RLIVLDKTIRDASKFGFGSLEELDKKGGGALGDALKAFEKYRSIfa 140 Wolinella succinogenes
jgi:Dacet_1053    97 DTILCQKVHRNAHKFGFKDLASIEEEGGKLVSGCLKKVEEIsee-- 140 Denitrovibrio acetiphilus DSM 12809
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap