Conserved Protein Domain Family
Lipoprotein_11

?
pfam03260: Lipoprotein_11 
Lepidopteran low molecular weight (30 kD) lipoprotein
Statistics
?
PSSM-Id: 397387
Aligned: 15 rows
Threshold Bit Score: 357.037
Threshold Setting Gi: 512937862
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P09335         8 AMCVPAAsagv-velSADSMSPSNQDLEDKLYNSILTGDYDSAVRKSLEYESQGQGSIVQNVVNNLIIDKRRNTMEYCYK 86  domestic silkworm
P09334        11 AVCALAS--------NATLAPRTDDVLAEQLYMSVVIGEYETAIAKCSEYLKEKKGEVIKEAVKRLIENGKRNTMDFAYQ 82  domestic silkworm
NP_001274758   7 iLCLFVAs------lYANETSVSDSKLEDDLYNSILVADYDHSVEKSKQIYEDKKSEVITNVVNKLIRNNKMNCMEYAYQ 80  domestic silkworm
XP_012550504   7 ILCLFVAs------lYAADSDVPNDILEEQLYNSVVVADYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAYQ 80  domestic silkworm
NP_001266369   7 VLCLFAAs------lYADEGTAFNEILAEHLYHDVIIADYDSAVERSKLIYTDNKGELITNVVNNLIRNNKMNCMEYAYQ 80  domestic silkworm
XP_004933868  56 AMSDIEA-----------------KNIEDALYNEIVSRDFYQAVHRTAIMYGAGWDSMITNVVNRLIDNGQSQLIDYAYK 118 domestic silkworm
XP_021207216   8 AICVLAIpr----nsGAVGLVTSRDRYVQIIYDAVNTEDYAKAVTASVHLRRETRGDVVVNAVTRLIEDGKRNILEFAYK 83  domestic silkworm
XP_012550429   8 ALCLVAAsatpsidgDDRYPIHAPSGYEDIVTNAIITRNYEAAASMTVQLKRRSSGRYITIIVNRLIRENKRNLCDLAYK 87  domestic silkworm
NP_001119728   8 STCVLAAsagl-idlDINILSAPTRA-ETRLVDAITTADYNTAVSLILLLEKQSSGSIIEDTVNNLIRDGNRNVLEFAYK 85  domestic silkworm
XP_021207210  45 PMCVLAAgggl-ldvDVDILSAPDKIEADNLYSSVITGDIDKAVVQTLALNLLSKGAIIEDVIARLIRDKKRNIFDYAYK 123 domestic silkworm
P09335        87 LW--VGNGQDIVKKYFPLSFRLIMAGNYVKLIYRNYNLALKLGSttNPSNERIAYGDGVDKHTDLVSWKFITLWENNRVY 164 domestic silkworm
P09334        83 LW--TKDGKEIVKSYFPIQFRVIFTEQTVKLINKRDHHALKLID--QQNHNKIAFGDSKDKTSKKVSWKFTPVLENNRVY 158 domestic silkworm
NP_001274758  81 LW--LQGSKDIVRECFPVEFRLIFAENNIKLMYKRDGLALTLDDe-NSNDGRLAYGDGKDKTSPKVSWKFVPLWENNKVY 157 domestic silkworm
XP_012550504  81 LW--LQGSKDIVRDCFPVEFRLIFAENAIKLMYKRDGLALTLSNdvQGDDGRPAYGDGKDKTSPRVSWKLIALWENNKVY 158 domestic silkworm
NP_001266369  81 LW--MQGSEDIVRDCFPVEFTLILAENYVKLMYRRDGLAFTLSD-----NGGVAYGDSKDRTSSRVSWKFIPLWENNKVY 153 domestic silkworm
XP_004933868 119 LT--ASRGTFIVRALFPSAVRLHEDLFFVKIISYKYDFALKFGLgaDFAGDKTAYGDSDTSTRFRVTWKFIPYWIEDRLY 196 domestic silkworm
XP_021207216  84 LWk-FDEGQQVVKELFPAQFKLIFSGNLVKIITIRDDLALKLAGaaDELNDRAAYGDGSDKTSENISWKFVPIWEDNRVY 162 domestic silkworm
XP_012550429  88 LWdyMDESQEIVKEYFPVIFRQIFSENSVKIINKRDNLAIKLGDalDSDNDRVAYGDANDKTSDNVGWKLIPLWDDNRVY 167 domestic silkworm
NP_001119728  86 LW--IGEGKEIVKHYFPVQFRQVLSESNVKIINKRDNLAIKLGAaaDSDNDRIAYGDANDKSSENVSWKLIPLWENNRVY 163 domestic silkworm
XP_021207210 124 LW--NGEGKDVVKQHFPMQFRLIFAENHVKIINKRDNLAIKLSTevDHQNDRSAFGDANEKTTDNVGWRFVHLWENNKVY 201 domestic silkworm
P09335       165 FKAHNTKYNQYLKMSTSTcNcNARDRVVYGGNSADSTREQWFFQPAKYENDVLFFIYNRQFNDALELGTIVNASGDRKAV 244 domestic silkworm
P09334       159 FKIMSTEDKQYLKLDNTK-G-SSDDRIIYGDSTADTFKHHWYLEPSMYESDVMFFVYNREYNSVMTLDEDMAANEDREAL 236 domestic silkworm
NP_001274758 158 FKIVNTQRNQYLTLAVQT-T-PNHNHMAYGANSVEGFKAQWTLQPAKYDNDVLFFMYNREYNEALVLSRPTDTWGNRMAF 235 domestic silkworm
XP_012550504 159 FKILNTERNQYLVLGVGT-N-WNGDHMAFGVNSVDSFRAQWYLQPAKYDNDVLFYIYNREYSKALTLSRTVEPSGHRMAW 236 domestic silkworm
NP_001266369 154 FKIENTERKQNLALKVRT-N-RNGDHMAYGVANFDGFRAQWYLVPAELNNEVLFFIFNRDYSMALTLSRTMDSLGNRMAW 231 domestic silkworm
XP_004933868 197 FKIRPIDIAYFLKLGNSR-D-KDGDHGAYGSTNHDTDRHLWYLKPVRHNGKLLFYIINKEYDELLKLGQSTDVDGDRTAY 274 domestic silkworm
XP_021207216 163 FKIFNIRRRQYLKLGVDA-D-GENDHAVFGDNFADTRRHEWYLKPVQLNGKLLFYIYNRQYNQGLKLSRTADSAGDRRAY 240 domestic silkworm
XP_012550429 168 FKIFSVHRNQYLKLGTRI-D-VDNDHGVYGDDRADTHRHQWYLKPVELENQVLFYIYNRQYDQALKLGRNVDSDGDRRAY 245 domestic silkworm
NP_001119728 164 FKIYSVRRHQYLKLGTGT-D-GENDHSVYGDDRADTHRHQWYLKPAKLDNQVLFYIYNRQYNQALKLSRSVDSDGDRRAY 241 domestic silkworm
XP_021207210 202 FKIVSVARNQFLKLGTDA-D-EAGDHIAYGADVANTFRHQWYLQPAKYEDDLLFLIYNREFNQVLKLGRVVDNMGDRRLY 279 domestic silkworm
P09335       245 GHDGEVAGLPDIYSWFITP 263 domestic silkworm
P09334       237 GHSGEVSGYPQLFAWYIVP 255 domestic silkworm
NP_001274758 236 GYSGRVVGSPEQYAWGIKA 254 domestic silkworm
XP_012550504 237 GYNGRVIGSPEHYAWGIKA 255 domestic silkworm
NP_001266369 232 GYNGRVIEKPEHNTWSIKV 250 domestic silkworm
XP_004933868 275 GHS-EKDFNPDKFAWYIKl 292 domestic silkworm
XP_021207216 241 SNAGEVDGQPELFGWSIVS 259 domestic silkworm
XP_012550429 246 SSSSSVEGQPELYAWSISI 264 domestic silkworm
NP_001119728 242 SSSSSVEGQPELFGWSISI 260 domestic silkworm
XP_021207210 280 GHNGDVSGSPELFGFFITP 298 domestic silkworm
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap