Conserved Protein Domain Family
XG_FTase

?
pfam03254: XG_FTase 
Xyloglucan fucosyltransferase
Plant cell walls are crucial for development, signal transduction, and disease resistance in plants. Cell walls are made of cellulose, hemicelluloses, and pectins. Xyloglucan (XG), the principal load-bearing hemicellulose of dicotyledonous plants, has a terminal fucosyl residue. This fucosyltransferase adds this residue.
Statistics
?
PSSM-Id: 397384
Aligned: 4 rows
Threshold Bit Score: 770.216
Threshold Setting Gi: 75131588
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_015642240  74 SPavwissanvggRGSSSDesilllhrpaaahdKLLGGLLADGFDEGSCHSRYQSAMYRRNNAGKePSPHLVSRLRRHEE 153 Japanese rice
Q6YUI8        90 NPshg------ggAAKHAD--------------ELLGGLLAPGMDRRSCRSRYQAAHYYKHFPYA-PSPHLLDKLRAYEA 148 Japanese rice
Q67TZ7        65 DP-----------AGTPPEsspa-------nrdRLLGGLLSPDIGESACLSRYKSSLHRKPSPHS-PSPYLVSRLRKYEA 125 Japanese rice
EEF47837      94 RP-----------AGDPYD--------------KLLGGLLAAGFSERTCLSRYQSAFYRKELPHK-PSSYLISKLRSYEI 147 castor bean
XP_015642240 154 LQRRCGPGTAAYSNAVESLRSGKSGGigsppQTECRYLVSISYRG--LGNRMLAAASAFLYAMLTDRVLLVDPSNEMGEL 231 Japanese rice
Q6YUI8       149 RHRRCAPGTPLYNRSVEQLRSGRSAG-----GVECNYVVWLPFDG--LGNRMLSMVSGFLYALLTDRVLLVDLPHDSSDL 221 Japanese rice
Q67TZ7       126 LHRKCGPGTLFYKKSLMQLTSAYSMG-----LVECTYLVWTPCGGshLGDRMLSMASAFLYALLTHRVFVVHVTDDMAGL 200 Japanese rice
EEF47837     148 LHKRCGPHTEFYKKALEQLKFGNQQA-----SSDCSYVVWISYSG--LGNRILTLASAFLYALLTNRVLLVDPGIDIIDL 220 castor bean
XP_015642240 232 FCEPFPGTTWLLPPGFPLTN-FTsFSVDTTESYGNMLKNKVIT----TDAAAGdvpTPHQQLPAFAYIHLDHDYTFHDKF 306 Japanese rice
Q6YUI8       222 FCEPFPGATWLLPPDFPVANlFG-LGPRPEQSYTTLLNKKKITavvnNDDDPAsknATAALPPPPAYVYLSLGYQMADKL 300 Japanese rice
Q67TZ7       201 FCEPFPAASWELPAGFLVHN-LTqLGRGSEHSYANLLGAKKIK----TDDPAG---VRSESLPSYAYVHLEHDYQQSDQL 272 Japanese rice
EEF47837     221 FCKPFPEVSWFLPTDFPLRDqFNsYNQMSPSCYGRMLKDSSST-------------NLHALKPP---------------- 271 castor bean
XP_015642240 307 FFCDDDQSVLRNVPWLVMRTDSYIVPGLFLVTGFQAELDSLFPETDAVFHHLARYLFHPNNHIWGLVTRYYDAYLATARQ 386 Japanese rice
Q6YUI8       301 FFCGDDQRALAKVNWLLLYSDLYFVPSLYSVAEFNGELRRLFPAKESACHLLARYLLHPTNAVWGMVTRYYNSYLAQASR 380 Japanese rice
Q67TZ7       273 FFCDDDQTVLAKVNWLILRSNLYFTPGLFLVPQFEDELRWMFPARDTVFHHIGRYLFHPSNKVWELITRYHTSYMAKFEE 352 Japanese rice
EEF47837     272 -----SHAFLQKIPWLIMKTDNYFIPSLFLIPSFEQELNSLFTNKETVFHFLGRYLFHPTNSVWGLITRYYHAYLAKADE 346 castor bean
XP_015642240 387 RVGVQVRVF-GARQESPKVLEQITACAHMENLLPDViTTGE-----PAATTRRRL------KPKAVLVTSLTS-WYYEKL 453 Japanese rice
Q6YUI8       381 RIGVQIRMFnFASIPVDDLYNQILTCSRQEHVLPETtTDNDndddlATAYDSNSSngsgggNYSAILIASLYP-DYYERI 459 Japanese rice
Q67TZ7       353 NIGIQITTFaGSKVSSEEYFKQIVACTSQEKILPEI----D-----PNATSSANEaalattASKAVLVSSAQPsEYAEKL 423 Japanese rice
EEF47837     347 KIGIQIRIFdSGTGPFQYVLDQILSCTTKEKILPEI-NRQD-----PSTSQSGDC------KSKAVVVTSLSP-WYSEKM 413 castor bean
XP_015642240 454 KGMYWERATATGEAVGVHQPSHEEYQRFGSGSHDAKACAEIYLLSLSDALVTSGWSTFGYVAQGLAGLTPRVMYKPANES 533 Japanese rice
Q6YUI8       460 RATYYEHATRGRVRVGVFQPTHEERQATQRLFHNQKALAEILLLGFSDELVTSGMSTFGYVGSSLAGVRPTILMPAHGHR 539 Japanese rice
Q67TZ7       424 KAMYYEHATVTGEPVSVLQPA-----GAGKQAPNQKALVEMFLQSYCDVSVVSGRSTVGYVGHGLAGVKPWLLLTPTNRT 498 Japanese rice
EEF47837     414 RNMYWEHPSMTSESVGIYQPSYEEYQQTEKQIHNRKAWAEMYLLSLTDVLVTSSWSTFGYVAQGLGGLKSWILYKPENQS 493 castor bean
XP_015642240 534 SavPDPPCRRDVSMEPCFLTPPynncR 560 Japanese rice
Q6YUI8       540 V--PAPPCRRAVSMEPCNLTPP----R 560 Japanese rice
Q67TZ7       499 As-ANPPCIQTTSMEPCFHAPPsydcR 524 Japanese rice
EEF47837     494 A--PDPPCVGAMSMEPCFHAPPfydcK 518 castor bean
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap