3M6E


Conserved Protein Domain Family
UT

?
pfam03253: UT 
Click on image for an interactive view with Cn3D
Urea transporter
Members of this family transport urea across membranes. The family includes a bacterial homolog.
Statistics
?
PSSM-Id: 397383
Aligned: 71 rows
Threshold Bit Score: 121.872
Threshold Setting Gi: 123657033
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3M6E_A           18 CDSVCRGCGQVMFQNNTVTGLLFFAGIFYNSTTLGVCAVLGTAASTLTAQLLGVDKPLVRAGLFGANGTLAGIALPFFF- 96  Desulfovibri...
Q2FVW6            1 --mLLKNISQVVLISNKWTGLFILIGLFVADWTIGLAAIVGSIIAYTFARFINYSEAEINDGLAGFNPVLTAIALTIFL- 77  Staphylococc...
Q5HLW4            4 IKVILSSISQVVLINNPYTGLFILIGLFAVNWKVGISAMIASVMTWILAPYMNYTKEEIESGLAGFNPVLTAIALTLFL- 82  Staphylococc...
EED88444          2 IEASLRGIAQVYFQNNPLSGLLILIAMFIQSTRVAVHGVIALVAGNLAGVLMGFDKSFLSCGLFGYNSFLVGLALATFY- 80  Thalassiosir...
WP_012500438     30 LQAVLNSYSQIFFSTHRAFALMILLVTFFD-FYTGLFGLLSVLTAAIAGKILGFNRLVLKNGLLGFNSLLVGLGLGAYY- 107 Chloroherpet...
CAO81620         14 flaipdsYATILFSDSVLLGLMLLTITLLS-PVVGLSGLFSLIVAILAARILGFEHWESSSGITAFNSLLAGMMVGYYYp 92  Candidatus C...
jgi:Nitsa_1538    5 ISLILRPYAAILFLENRIAGALLLLLTFAE-PTVGISGLFALLCTIVFAEFAGLRHTYLEHGFYLYNSLLVGLGIGFLF- 82  Nitratifract...
WP_012081874     17 IRLFPKSYISILFLREVKAGVILLLLSFLL-PSVGFLGLVAIIATILFAELTGLREHYLKYGFYLYNSLLVGMGIGFYY- 94  Nitratirupto...
WP_012663833      4 LKFVFKPYISILFLRDVKAGVALFLLSFLL-PSVGFLGLVGIIATVLFAEFINVRDEYLKYGFYLYNSLLVGMGVGYFF- 81  Nautilia pro...
jgi:Dester_0870   7 flpIVRSYSAILFNSSAKGGIILLLLTFIN-PNLGIGGFTAVASAYIFARLVGFKEEFLRLDYYIYNPLLVGLSLGYLF- 84  Desulfurobac...
3M6E_A           97 -----NYE--PAMLGYVALNGA----FTTIIMASLln-flGKWGVPALTAPFVLATWLL--------MFGVYKLslfhPG 156 Desulfovibri...
Q2FVW6           78 -----DKS--GLDIVITMIATL----LTLPVAAAVre-vlRPYKVPMLTMPFVIVTWFT--------ILLSGQVkfvdTS 137 Staphylococc...
Q5HLW4           83 -----DSN--WSGILITFVATI----LTLPIGAAVre-vlKPHKIAFLTSPYVIMTWIT--------LLIPNQLktlhTQ 142 Staphylococc...
EED88444         81 -----SGEkhTDYYWPVVIGAIvfacFSSILFVMLgk-ilSPYKTPPFTLPFNISTVAF--------LLATGSMnnvdMA 146 Thalassiosir...
WP_012500438    108 -----APS--VYLLVIIILGAL----FAMLISVSLqg-viGKYGLPFLSVPFIIALWAF--------MLATQSFhaleIN 167 Chloroherpet...
CAO81620         93 mqiisSSS--INYLCFLLLVSL----FTLLLYLFSsylfqQFFRLPSMSLSFSIVAILLwyyfarkgYLSNYPFdkill- 165 Candidatus C...
jgi:Nitsa_1538   83 -----TPS--VMSFLFIFLLAV----LTFLSSFSIst-lfARWRIPPLSLPFALVTALA--------YLAAMNYngllAH 142 Nitratifract...
WP_012081874     95 -----EIS--ILSIFLTSLLAI----LTFLLSFGLnr-ifIHYALPILSLPFALVSLLF--------YLASLKYttllSN 154 Nitratirupto...
WP_012663833     82 -----DVT--FITILLTIMLSI----LTFLVSFSInk-vfIKYSLPLLSLPFAFVSMIF--------YLASLKYtgllSN 141 Nautilia pro...
jgi:Dester_0870  85 -----KVN--FLSLFFFSIAGI----LSFLLTYILssifsYYLKLPVLSVPFVVASSLL--------YLAASKFsnlfVS 145 Desulfurobac...
3M6E_A          157 ALIAPALPSvagla---------dmgtvTGRTFMEGLFKGVGEVMFQDNIVTGVIFVVAILVNSRISALFAVIGSLVGLC 227 Desulfovibri...
Q2FVW6          138 LKLMPQNIEtvnf------------snnDRIHFIQSLFEGFSQVFIEASVIGGVCILIGILIASRKATLLAVIASLLSFI 205 Staphylococc...
Q5HLW4          143 IDIIPEHIEkvsl-----------nndhTRVHFFQSVLDGFGQIFLMPSIIGGLLILIGIFIGSKKAGIVSIIANIIGFL 211 Staphylococc...
EED88444        147 SVREPSLPSyevsl---------dieslTARAFFAGSIRGVGQVYLANSIASGVLVLIGIFICSRIQGFAAFFGSIIGAG 217 Thalassiosir...
WP_012500438    168 ERGIYIFNElyavggkplvaayeflknlEMPAALQAYFISLSAILFQQNILTGFIVSLGLLFFSRIAFSLSLLGFFLAYG 247 Chloroherpet...
CAO81620        166 -----------------------fsptlKLPEFWRLFFISLGSIFFTPEVSAGILVSIALLIITRIGFGLALLGWTLNY- 221 Candidatus C...
jgi:Nitsa_1538  143 FHNglah------------------yafLGDTSLGSYLSSLGSIFFLPNQAAGLVMALILLVISPTLFSLSLAGFYTGVA 204 Nitratifract...
WP_012081874    155 Llhrs--------------------pliDVQLPFAPFFQSLGTIFFLPYSIAGAIIALIILYYSRILFFLAVSGYLFGIA 214 Nitratirupto...
WP_012663833    142 Ilyrr--------------------alfDIHLPFEAFFKSMGTIFFLPYTFAGLIIVLIILFYSRILFLLAFIGFWLGVW 201 Nautilia pro...
jgi:Dester_0870 146 SLYPHfesl----------------fnlHLPLLVEGFFKSLGAIFFMPTPFEGFVIFLILLTISRILSLLALTGYLVGTF 209 Desulfurobac...
3M6E_A          228 TALIMHSPETPVRLGLY--GFNSVLCGIAMGGiffyLNIRTFLYALGCMVLGAIATG----------AFSVllspIGMPA 295 Desulfovibri...
Q2FVW6          206 IVALLGGNYDDINQGLF--GYNFVLMAIALGYtf-kTAINPYISTFLGVLLTVVVQL----------GTTTllepFGLPA 272 Staphylococc...
Q5HLW4          212 IIILLGGDYSSINEGIF--GYNVVLSAIALGVtf-eTAIHSYLAMILGIVLTAFIHL----------GLSTllapLGLPT 278 Staphylococc...
EED88444        218 VAAFVRSPASAIENGMY--GFNPSLTMSAM-LlfyvPSFGSTSIGILASVITVFIQL----------ALATslepCGLPF 284 Thalassiosir...
WP_012500438    248 FYTLIGADIPSYDYAFF--GFNYILSSIALGGffliPSRNAYLWMILLIPFVAVLAI----------SMNMiflqFRLPI 315 Chloroherpet...
CAO81620        222 --ILMRLAGVQPGSGVFysGFNAILIMYAVAGiyllPGKSSILIGLIATGIGFLFTAlfnvvyyyynAFTGlytpLAVPV 299 Candidatus C...
jgi:Nitsa_1538  205 THALLIGSWSAAYHDVY--AFNYILVAMALGGifllPFWRNYIYAGIAVALSVIFAD----------ATKIffnyYSLPV 272 Nitratifract...
WP_012081874    215 VH-SLFVPIPSAIHSLY--NFNYILIAMAVGGvfliPHIRSYLIAFTAVAASVVMID----------AMEVffnlYSLPV 281 Nitratirupto...
WP_012663833    202 FH-SFFVPFPQALNSPY--NFNYILIAMALGGvfliPNIKNFFLAVLAVFLSIVLID----------AMEVffniYALPV 268 Nautilia pro...
jgi:Dester_0870 210 TKAVFVGSFYQAVSDSS--AFNYILTSMAIGGvfliPSLRSYKFAIISTILSVPIVE----------GAKVfwesYGLPV 277 Desulfurobac...
3M6E_A          296 LTWPFIVVTWLFLFAGS 312 Desulfovibrio vulgaris str. Hildenborough
Q2FVW6          273 LTLPFIIVTWILLFAGI 289 Staphylococcus aureus subsp. aureus NCTC 8325
Q5HLW4          279 LTWPFIFATWIMLFAGI 295 Staphylococcus epidermidis RP62A
EED88444        285 MTLPFCFAALAFIVIQG 301 Thalassiosira pseudonana CCMP1335
WP_012500438    316 YSLPFNMVVLLFLYALk 332 Chloroherpeton thalassium
CAO81620        300 FAFPFNIVVLLVIFslr 316 Candidatus Cloacimonas acidaminovorans str. Evry
jgi:Nitsa_1538  273 FTLPFNAVVMVVLFllv 289 Nitratifractor salsuginis DSM 16511
WP_012081874    282 YTLPFNIITLLIILLTf 298 Nitratiruptor sp. SB155-2
WP_012663833    269 YTLPFNFTTLLFIMILy 285 Nautilia profundicola
jgi:Dester_0870 278 FALPFNATTHLLLYvll 294 Desulfurobacterium thermolithotrophum DSM 11699
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap