Conserved Protein Domain Family
Tropomodulin

?
pfam03250: Tropomodulin 
Tropomodulin
Tropomodulin is a novel tropomyosin regulatory protein that binds to the end of erythrocyte tropomyosin and blocks head-to-tail association of tropomyosin along actin filaments. Limited proteolysis shows this protein is composed of two domains. The amino terminal domain contains the tropomyosin binding function.
Statistics
?
PSSM-Id: 397382
Aligned: 24 rows
Threshold Bit Score: 158.211
Threshold Setting Gi: 675859426
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003109350  47 YNKGLKDLEDNDIEGLLSKLSIDELEDLN-NDFDPDNSMLPPSQRCRDQTDKEPTGPYKRDNLLKFLEEKAKTEKDWDDV 125 Caenorhabditis ...
XP_001633911   8 EKVNLGEFEDINEDEIVEGLTEEELKQLN-LAIDPENQYLPAYMRQEDQTDKVQTTPFDREKLLKHLEEQAKNDKEREEA 86  starlet sea ane...
XP_786260      4 LKNDYNKYADIDEDEILKNLTEEQLEELA-YELDPDNNMLPASDRMRPQTKKAPTGKFDRKQLLEFLEKKAKEEKDWEEK 82  purple sea urchin
CCD79981       7 FGKALTSYDDEDIDELLSKLTPEELEQLN-DDFDPDNSLLPPSQRCRDQTTKTPTGPFDREKLLRYLIEKAKAEKDWEEA 85  Schistosoma man...
EFX74286       7 YGKELKEFDDVDVDDLLTQLSAEELEILS-KEVDPDDRFMPPDQRTNYHCEREATGPVDRKQLIDHINKIALETPDQPES 85  common water flea
XP_003242369  93 YGKNLSDYDELDVDQLLSQLSPEEISILA-KEVDPDDNLLPPSERCSYECNKEATGPLNRKKLIEHINKQALETPDLPEI 171 pea aphid
Q173S8        21 YGKDLGAYDDVDVDELLSQLSPEEITMLA-KEVDPDDSFLPPSQRTNYECTKDPTGPLDRKKLIDHINKQALETPDKPEL 99  yellow fever mo...
O46231        19 YGKDLSEYDDVDVESLLAQLSPEEITILA-KEVDPDDNFLPPDQRNSYECTKEATGPLNRKQLIEHINKQAIETPDQPEF 97  fruit fly
XP_009015273   7 FNRDVKTFKESEIDDLLSKLTKEELEELHlELVDSDDPHIPPSDRCRYKTDKEASGPFDRQKLLEYLETKAAKEKDWADA 86  Helobdella robusta
XP_003373207  63 YGRDLSEYEDIDIDSLLTKLTPEELEELN-SEVDPDNSLLPPSQRCRDQTTKSPTGPFRREELLKFLEEKAKNEADWEEK 141 Trichinella spi...
XP_003109350 126 CPYtAGVKRGKVYDSDSGRNsEEPDTGKmem--pieIDLdddEEELECALVSAPEKDLVDLAGILGMHNVLNQ 196 Caenorhabditis remanei
XP_001633911  87 VPF-KKETRGKVFVKKERPKrDDPVPML--------------PDDLSDVLENATEEQLLELAGVLGIHSMLTS 144 starlet sea anemone
XP_786260     83 VPFkSGQKRGKVYERKEDEKsEEKSNGKg------------kPEEWEHELDGATEEDLVELAGILGLHSMLDQ 143 purple sea urchin
CCD79981      86 VPY-EKKKRGKVYTP---KQiMSPSTQNelvemgfdVEF---DDDVNKALENATEDELVDLAAVLGFTGMLNQ 151 Schistosoma mansoni
EFX74286      86 VPFvAGVVRGKKWIPPE-APvIVSREDDgv-----sFNL---EDEYEQALGTATEEELVDLAAILGFHSMMNQ 149 common water flea
XP_003242369 172 KPYvAGTVRGKKWVAP--ETnGNTEHEDki-----aIDI---DDEYGDALNTASQEEIIDLAAILGFHSMMNQ 234 pea aphid
Q173S8       100 EPFvPGTVRGKKWIPPP-MErKLQEAAEqi-----aIDM---GDEYEQALNDATQEEIIDLAAILGFHSMMNQ 163 yellow fever mosquito
O46231        98 EPFvQGKVRGKKWVPPP-RDaRDIEAEEqi-----aIDM---GEEYEHALNDATQEEIIDLAAILGFHSMMNQ 161 fruit fly
XP_009015273  87 KPY-VKETRGKVWKPKEADKvVIRKDLDdv-----------vETEWDEALKSATEDELVDLAAVLGFHGLLNQ 147 Helobdella robusta
XP_003373207 142 VPFkQGVKRGKAYVP---SVvEEKKETFgi-----dLAKaleMDEVEIALSEATENDLVDLAGILGMHSMLTQ 206 Trichinella spiralis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap