Conserved Protein Domain Family
TSA

?
pfam03249: TSA 
Type specific antigen
There are several antigenic variants in Rickettsia tsutsugamushi, and a type-specific antigen (TSA) of 56-kilodaltons located on the rickettsial surface is responsible for the variation. TSA proteins are probably integral membrane proteins.
Statistics
?
PSSM-Id: 397381
Aligned: 2 rows
Threshold Bit Score: 1087.13
Threshold Setting Gi: 156630911
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q02938  23 IELEDEVGLECGPYAKVGVVGGMITGAESTRLDSTDSEGKKHLSLTTGLPFGGTLAAGMTIAPGFRAELGVMYLRNISAE 102 Orientia tsutsugamush...
Q02938  23 IELEDEVGLECGPYAKVGVVGGMITGAESTRLDSTDSEGKKHLSLTTGLPFGGTLAAGMTIAPGFRAELGVMYLRNISAE 102 Orientia tsutsugamush...
Q02938 103 VEVGKGEVDSKGEIKADSGGGTDAPIRKPFKLTPPQPTMMPISIADRDFGIDIPNIPQAQAQAAQPPLNDQKRAAARIAW 182 Orientia tsutsugamush...
Q02938 103 VEVGKGEVDSKGEIKADSGGGTDAPIRKPFKLTPPQPTMMPISIADRDFGIDIPNIPQAQAQAAQPPLNDQKRAAARIAW 182 Orientia tsutsugamush...
Q02938 183 LKNCAGIDYMVKDPNNPGHMMVNPVLLNIPQGNPNPVGQPPQRANQPANFAIHNHEQWRSLVVGLAALSNANKPSASPVK 262 Orientia tsutsugamush...
Q02938 183 LKNCAGIDYMVKDPNNPGHMMVNPVLLNIPQGNPNPVGQPPQRANQPANFAIHNHEQWRSLVVGLAALSNANKPSASPVK 262 Orientia tsutsugamush...
Q02938 263 VLSDKIIQIYSDIKPFADIAGINVPDTGLPNSASIEQIQSKIQELGDTLEELRDSFDGYINNAFVNQIHLNFVMPPQAQQ 342 Orientia tsutsugamush...
Q02938 263 VLSDKIIQIYSDIKPFADIAGINVPDTGLPNSASIEQIQSKIQELGDTLEELRDSFDGYINNAFVNQIHLNFVMPPQAQQ 342 Orientia tsutsugamush...
Q02938 343 QQGQGQQQQAQATAQEAVAAAAVRLLNGSDQIAQLYKDLVKLQRHAGIRKAMEKLAAQQEEDAKNQGKGDCKQQQGASEK 422 Orientia tsutsugamush...
Q02938 343 QQGQGQQQQAQATAQEAVAAAAVRLLNGSDQIAQLYKDLVKLQRHAGIRKAMEKLAAQQEEDAKNQGKGDCKQQQGASEK 422 Orientia tsutsugamush...
Q02938 423 SKEGKVKETEFDLSMVVGQVKLYADLVTTESFSIYGGVGAGLAYTYGKIDNKDVKGYTGMVASGALGVAINAAEGVCVDL 502 Orientia tsutsugamush...
Q02938 423 SKEGKVKETEFDLSMVVGQVKLYADLVTTESFSIYGGVGAGLAYTYGKIDNKDVKGYTGMVASGALGVAINAAEGVCVDL 502 Orientia tsutsugamush...
Q02938 503 EAGYMHSFSKVEDKYQVNAFIASACVRYNF 532 Orientia tsutsugamushi str. Boryong
Q02938 503 EAGYMHSFSKVEDKYQVNAFIASACVRYNF 532 Orientia tsutsugamushi str. Boryong
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap