5FVD,2WJ8


Conserved Protein Domain Family
Pneumo_ncap

?
pfam03246: Pneumo_ncap 
Pneumovirus nucleocapsid protein
Statistics
?
PSSM-Id: 397378
Aligned: 4 rows
Threshold Bit Score: 694.423
Threshold Setting Gi: 298351742
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5FVD_A   1 MSLQGIHLSDLSYKHAILKESQYTIKRDVGTTTAVTPSSLQQEITLLCGEILYAKHADYKYAAEIGIQYISTALGSERVQ 80 
O42053   1 MALSKVKLNDTLNKDQLLSSSKYTIQRSTGDNIDTPNYDVQKHLNKLCGMLLITEDANHKFTGLIGMLYAMSRLGREDTI 80  Human respiratory syn...
Q6WBA1   1 MSLQGIHLSDLSYKHAILKESQYTIKRDVGTTTAVTPSSLQQEITLLCGEILYAKHADYKYAAEIGIQYISTALGSERVQ 80  Human metapneumovirus...
2WJ8_A   1 MALSKVKLNDTLNKDQLLSSSKYTIQRSTGDSIDTPNYDVQKHINKLCGMLLITEDANHKFTGLIGMLYAMSRLGREDTI 80 
5FVD_A  81 QILRNSGSEVQV--VLTRTYSlgKIKNNKGEDLQMLDIHGVEKSWVEEIDKEARKTMATLLKEsSGNIPQNQRPSAPDTP 158
O42053  81 KILKDAGYHVKAngVDITTYR--QDINGKEMKFEVLTLSSLTSEIQVNIEIESRKSYKKMLKE-MGEVAPEYRHDSPDCG 157 Human respiratory syn...
Q6WBA1  81 QILRNSGSEVQV--VLTRTYSlgKVKNNKGEDLQMLDIHGVEKSWVEEIDKEARKTMATLLKEsSGNIPQNQRPSAPDTP 158 Human metapneumovirus...
2WJ8_A  81 KILRDAGYHVKAngVDVTTHR--QDINGKEMKFEVLTLASLTTEIQINIEIESRKSYKKMLKE-MGEVAPEYRHDSPDCG 157
5FVD_A 159 IILLCVGALIFTKLASTIEVGLETTVRRANRVLSDALKRYPRMdIPK-IARSFYDLFEQKVYHRSLFIEYGKALGSSSTG 237
O42053 158 MIILCIAALVITKLAAGDRSGLTAVIRRANNVLKNEIKRYKGL-IPKdIANSFYEVFEKHPHLIDVFVHFGIAQSSTRGG 236 Human respiratory syn...
Q6WBA1 159 IILLCVGALIFTKLASTIEVGLETTVRRANRVLSDALKRYPRMdIPK-IARSFYDLFEQKVYYRSLFIEYGKALGSSSTG 237 Human metapneumovirus...
2WJ8_A 158 MIILCIAALVITKLAAGDRSGLTAVIRRANNVLKNEMKRYKGL-LPKdIANSFYEVFEKHPHFIDVFVHFGIAQSSTRGG 236
5FVD_A 238 SKAESLFVNIFMQAYGAGQTMLRWGVIARSSNNIMLGHVSVQAELKQVTEVYDLVREMGPESGLLHLRQSPKAGLLSLAN 317
O42053 237 SRVEGIFAGLFMNAYGSGQVMLRWGVLAKSVKNIMLGHASVQAEMEQVVEVYEYAQKLGGEAGFYHILNNPKASLLSLTQ 316 Human respiratory syn...
Q6WBA1 238 SKAESLFVNIFMQAYGAGQTMLRWGVIARSSNNIMLGHVSVQAELKQVTEVYDLVREMGPESGLLHLRQSPKAGLLSLAN 317 Human metapneumovirus...
2WJ8_A 237 SRVEGIFAGLFMNAYGAGQVMLRWGVLAKSVKNIMLGHASVQAEMEQVVEVYEYAQKLGGEAGFYHILNNPKASLLSLTQ 316
5FVD_A 318 CPNFASVVLGNASGLGIIGMYRGRVPNTELFSAAESYAKSLKESNKINFSSLGLTDEEKEAAEHFLNVSDDSQnD 392
O42053 317 FPNFSSVVLGNAAGLGIMGEYRGTPRNQDLYDAAKAYAEQLKENGVINYSVLDLTAEELEAIKNQLNPKEDDV-E 390 Human respiratory syncytia...
Q6WBA1 318 CPNFASVVLGNASGLGIIGMYRGRVPNTELFSAAESYAKSLKESNKINFSSLGLTDEEKEAAEHFLNVSDDSQnD 392 Human metapneumovirus CAN9...
2WJ8_A 317 FPHFSSVVLGNAAGLGIMGEYRGTPRNQDLYDAAKAYAEQLKENGVINYSVLDLTAEELEAIKHQLNPKDNDVel 391
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap