2YYI


Conserved Protein Domain Family
HpaB

?
pfam03241: HpaB 
Click on image for an interactive view with Cn3D
4-hydroxyphenylacetate 3-hydroxylase C terminal
HpaB encodes part of the 4-hydroxyphenylacetate 3-hydroxylase from Escherichia coli. HpaB is part of a heterodimeric enzyme that also requires HpaC. The enzyme is NADH-dependent and uses FAD as the redox chromophore. This family also includes PvcC may play a role in one of the proposed hydroxylation steps of pyoverdine chromophore biosynthesis.
Statistics
?
PSSM-Id: 397375
Aligned: 138 rows
Threshold Bit Score: 165.767
Threshold Setting Gi: 500019999
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2YYI_A          277 ATGALNHMAHQVvaLKTAKTEAFLGVAALMAEGIGADVYGHVQEKIAEIIVYLEAMRAFWTRAEEEAKEN---------- 346 Thermus ther...
Q3ABD4          279 LFATYHRHSYTG--CKPAVTDIIMGTAALVAEYNGVEKASHVRDALAELIAVAELVYGAGIAAGVKAKRA---------- 346 Carboxydothe...
Q24N71          299 MFAHFHRHSYTG--CKTAVSEVIGAQAALVADVNDIAKEHHVREKVCEIISTAELVFAAGQASALRAVKF---------- 366 Desulfitobac...
WP_014826113    280 LFALFHRHSYSG--CKPASLDYVIGLASLAAEINGIGKTHNVREMLSELIMTGELGYAAGFTASALAKPEvympgmgmvp 357 Desulfosporo...
O29235          279 LFALFHRHSYTG--CKPATTDMIMGFGALIAEYNGVYEKHNIREKLVELAATAELVFAAGVAAAHYGQKS---------- 346 Archaeoglobu...
WP_011700717    285 YFTANYRACIGA--CVAGQGDVMIGAGALMARTNGLAAAT-FSAKMVEMAVNNETTYCMGIGAMALGKKG---------- 351 Syntrophobac...
KUCSBL:ELI_0281 288 RFACYHRQNYGG--CKGGVSDVVVGAAALMADYSGYGKAGHVKEKINEMIHLTETLYACSLACSCEGKPT---------- 355 Eubacterium ...
jgi:Desti_0809  288 RFATLHRQNYGG--CKGGVSDIVIGASALAAQYQGTLNASHIKDKLVEMLHLAETVYAGSVACSAMGSKT---------- 355 Desulfomonil...
WP_014809852    288 RFATLHRQNYGG--CKGGVSDIIIGATALAAEMQGSAGASHVKDKLAEMMHLTETIYSGSISCSAMGRKT---------- 355 Desulfomonil...
jgi:Desti_3009  280 LFALFHRHSYSG--CKPAVGDILLGLASLVSEVNGIEKADHVREHLAELITIAELGYAAGYTASSLGKPElfipgvgvrr 357 Desulfomonil...
2YYI_A          347 -AYGLLVPDRGALDGARNLYPRLYPRIREILEQIGASGLIT--LPSEKDFKGP-LGPFLEKFLQGAA-LEAKERVALFRL 421 Thermus ther...
Q3ABD4          347 -ASGTYIPEVVYANVARYHAGVNVYREFELLAELAGGLPAT--LPPEGDFYNEeTKGYLEKYLMRKAgISAENQHRCFRF 423 Carboxydothe...
Q24N71          367 -PNGSWVPDEILTNAGRKLAGQKIYHEYETLADLTGGICAS--LPTEESFFAPeTAELCNKYIMRNPdYTAEETHRVMRM 443 Desulfitobac...
WP_014826113    358 yGPGSFIPNSIYANVGRCLTGEAVFQEQEILCNIAGGMPAT--FPFERDLMNPeTKQLLEKYLNRNPqIPIEDQIKFWLN 435 Desulfosporo...
O29235          347 -PAGTFIPNEVYANVGRRHAGLNYYKELEILAELSGGLPAA--LPFAEDFLSEeVGPYIRKYIKRRAdVPAEHVYRCLFG 423 Archaeoglobu...
WP_011700717    352 -PGGMWVADSLTAHTNKVHVATLPYETKRLCQDIGGGVVETgcFPSSKDFNDPkYGHLVRKALQASAkFSAETRARAARL 430 Syntrophobac...
KUCSBL:ELI_0281 356 -ESGAYFVDPLLANVGKHNVTQLIYDIDRLAQDIGGGIIAT--MPSESDLRNPeIGKYVDKYLKGVAdVPTEDRMRIGRL 432 Eubacterium ...
jgi:Desti_0809  356 -KSGAYYPDPLLANCTKQNITRFIYEISRLAHDIGGGILAT--LPFDTDLKHPeIGKYVEKYLKGVEgVSTETRIKVLRL 432 Desulfomonil...
WP_014809852    356 -PSGAFYPDPLLANCTKQNVTRHIYEIARLAHDVAGGILAT--MPFENDLKSKeIGKYVEKYLAGVPgVSTENRIRILRL 432 Desulfomonil...
jgi:Desti_3009  358 yGPGSYIPNSIYANVGRCLTGDSVYHEQEILCKLAGGMPAT--FPFEQDLFNEdLKPLLDKYIRRNPnIPVEEQIKFWLF 435 Desulfomonil...
2YYI_A          422 AWDMTLSGFGARQELYERFFFGDPVRMYQTLYNVYNKEPYKERIRAFLK 470 Thermus thermophilus HB8
Q3ABD4          424 ISDLLVSAQAGVKQVAGVHGGGSPIMEKITIYGQYNIEEKKKLAKYLAG 472 Carboxydothermus hydrogenoformans Z-2901
Q24N71          444 MEDKLCDAFESAQAVAGVHGGGSPLMETITMMSRYDLEPLKDIAKYLAG 492 Desulfitobacterium hafniense Y51
WP_014826113    436 FIDFGLSGYAGTSQYGAYHGGGSPIMEQIAITSQYDIESKKDIVREIAG 484 Desulfosporosinus acidiphilus
O29235          424 ISNILCSSLGGVQAVAGVHGGGSPVMEEIAIWRSYDFEKKKDIAKYLSG 472 Archaeoglobus fulgidus
WP_011700717    431 SEWLTLGAGVPG----CMHGGGSPDGAKLVVRAFTPVNEFADYARKIAG 475 Syntrophobacter fumaroxidans
KUCSBL:ELI_0281 433 IENMTGGTA----LVESMHGAGSPQAQKVMYSKLSNLEKKKEFAAHLAG 477 Eubacterium callanderi
jgi:Desti_0809  433 LENMTGGTA----LIESMHGAGSPQSQRVMYQRLGKLGEKMKMAKKVAK 477 Desulfomonile tiedjei DSM 6799
WP_014809852    433 IENMTGGTA----LVESMHGAGSPQTQKVMYGRLSKLDMKKKMAKKLAG 477 Desulfomonile tiedjei
jgi:Desti_3009  436 FTDFACSAAGAVFNYAGVHGGGSPIMEQIAITSQFDITSRKNIVKRLAG 484 Desulfomonile tiedjei DSM 6799
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap