Conserved Protein Domain Family
Otopetrin

?
pfam03189: Otopetrin 
Otopetrin
Statistics
?
PSSM-Id: 397346
Aligned: 51 rows
Threshold Bit Score: 198.254
Threshold Setting Gi: 555687120
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9W4A6       203 FLRVGAIAFGLGAMIYIGLEFG---SFFEI----PFDSPCHH-------------ILIGVNPLLQMIFTFMQMYFIFMNA 262 fruit fly
CAP34165     158 YLRLGALFFGSVGIVLFGLELF---LCIEN--------ATCK-------------KVTIAKMIVAIIFTFIQMHFIFCNS 213 Caenorhabditis ...
Q22977       146 YLRLGTVLFGTLGSVLWGCEIF---LCFFT--------ETRH-------------NIYVVKYILAFLFTYLQMHFLCCNS 201 Caenorhabditis ...
XP_003110541 162 YLRLGALLFGTLGSVLWGCEIY---LCFAG--------ECVH-------------RLVVSKHIAAIIFTFLQMHFIVCNS 217 Caenorhabditis ...
Q22976       160 YLRLGAIFFGTLGSVLWGCEIF---LCFSG--------ECVH-------------RLVVAKHIAAIIFTFLQMHFIVCNS 215 Caenorhabditis ...
PDM84064     193 YLRIGCVVFGLIGVVYYVLMAL---VCTFGw--dGITANECN-------------ASGIAISVMAALFVFSQMWFVYCNG 254 Pristionchus pa...
XP_002634537 177 FLRLGSVVFGVTGVVYYAFLVF---LCELD--------TNCS-------------ALSTSLDVCAIFFIFIQMHFIFCNW 232 Caenorhabditis ...
ESN90352     137 FV-AGLVLFYTLSFVMDFVHLM-------------AKVDCSPvwmackynvkvtfIVDVIFHITRIVFFGCSTFFAIVYR 202 Helobdella robusta
EFA02328     335 YLKIGAAVFCLGHLIHSGLLIGy--QILFLtsdgEDFYKCAT-------------VTSLILDIVYPIYSFFLLYFIFKYS 399 red flour beetle
6_pfamImport   1 YMKVGAAGFCLGHLIHSGLLISyqlAFLMTd--sANFLRCAS-------------IATLVLDLLYPTYSFLQLFFIFKYS 65 
Q9W4A6       263 RLNIHR-FKVIARFGLMHVVATNICVWIRTLVKE-----SLLEITIYHQKN-EPEAGASSIAHSIRQHALRHAGTVLrth 335 fruit fly
CAP34165     214 KITVNS-SRKIVAFGMMHLISVNLWTWFRFVLAKqeakaHKKAMLKQTFRKyYSSSSSSSSSEEI--------------- 277 Caenorhabditis ...
Q22977       202 KIDLPK-NNFLASFGMMHCVAVNLWVWFSLCLAKavyksDKKT----------LKLQKAEEKYKKKNMTITEA------- 263 Caenorhabditis ...
XP_003110541 218 KITFHR-SNHLASFGMMHCVAVNIWTWFSMCLVKaqvkrLKKQ----------KKEMEYHKNSTDSYSSSSSSSSSSsee 286 Caenorhabditis ...
Q22976       216 KITFHR-SNILASFGMMHCVAVNLWTWFSMCLVKaqvkkLKKQ----------KKELEYHSSSSSSSDSSSSSEEILepe 284 Caenorhabditis ...
PDM84064     255 KIAINGnSRYYISLGLMHLVATNLWLWIRYILYE--------EAQTLKEIR-LAKFDHNSTSTSDILQDL---------- 315 Pristionchus pa...
XP_002634537 233 KLSITG-SHMVARIGTMHLVAANLWTWIRYVLMEegvmeKEIR----------EVFKHRPMMGHYRNLSFDSSESS---- 297 Caenorhabditis ...
ESN90352     203 SFIFAS--KCWVRYSLAVLFGVNLALWFDVLLHE-------------------SARIINNSSSSAIIDNE---------- 251 Helobdella robusta
EFA02328     400 NIIVNR-HLAVVRFGLMHCIASSLCFWVWTILRE-----TIESLSHHKEDS-ASEELPTTSESAFFSSPQ------A--- 463 red flour beetle
6_pfamImport  66 NVIINR-FKVAGRFALMHCIGSNLCFWIWTILREtvdslYHGE----------DAPVSLHHLNSHKAMYMTGMFLAVf-- 132
Q9W4A6       336 agpnsefevldgedilpkdvyksdnvlsklvrntvdgiskslgmggdqaldssttssstttttrapfttpnyqwhsttma 415 fruit fly
CAP34165         --------------------------------------------------------------------------------     Caenorhabditis ...
Q22977           --------------------------------------------------------------------------------     Caenorhabditis ...
XP_003110541 287 edel---------------------------------------------------------------------------- 290 Caenorhabditis ...
Q22976           --------------------------------------------------------------------------------     Caenorhabditis ...
PDM84064         --------------------------------------------------------------------------------     Pristionchus pa...
XP_002634537     --------------------------------------------------------------------------------     Caenorhabditis ...
ESN90352         --------------------------------------------------------------------------------     Helobdella robusta
EFA02328         --------------------------------------------------------------------------------     red flour beetle
6_pfamImport     --------------------------------------------------------------------------------    
Q9W4A6       416 rklkkfitsattaattaagssstasstttisptissttipsttisstTISSSTTFSPFSPSTTTTTTTTAAAlnletsgs 495 fruit fly
CAP34165     278 ------------------------------------------------------------HELISAVLNSTI-------- 289 Caenorhabditis ...
Q22977       264 ---------------------------------------------------VAETITTTIASIVSSESSSGFradekq-- 290 Caenorhabditis ...
XP_003110541 291 -----------------------------------------esstvlEGLVEAVVEKMKPMMSSYSSSTSSY-------- 321 Caenorhabditis ...
Q22976       285 --------------------------------------------sstLLENLIEVVLEKLKPGKGTTYTSTP-------- 312 Caenorhabditis ...
PDM84064     316 -----------------------------------------------LAVDSHGGSHHDDNNSTDFIHALHT-------- 340 Pristionchus pa...
XP_002634537 298 ------------------------------------------------QEQSSEMFSSHEDEHDKKIVGSCQ-------- 321 Caenorhabditis ...
ESN90352     252 -------------------------------------------------------IIIIRCLQRNDSTDMQShn------ 270 Helobdella robusta
EFA02328     464 -----------------------------------------------LPLISYDKRGAKLLTAYLNTTVRQF-------- 488 red flour beetle
6_pfamImport 133 -----------------------------------------------NSVYDQNIFKNREIPRNSVRQTALI-------- 157
Q9W4A6       496 espfgglqrilssaappslapvdgfgsasaatptsgsgagsfvdsflastlspasstegsasimnnlfgqgpmensfqty 575 fruit fly
CAP34165         --------------------------------------------------------------------------------     Caenorhabditis ...
Q22977           --------------------------------------------------------------------------------     Caenorhabditis ...
XP_003110541     --------------------------------------------------------------------------------     Caenorhabditis ...
Q22976           --------------------------------------------------------------------------------     Caenorhabditis ...
PDM84064         --------------------------------------------------------------------------------     Pristionchus pa...
XP_002634537     --------------------------------------------------------------------------------     Caenorhabditis ...
ESN90352         --------------------------------------------------------------------------------     Helobdella robusta
EFA02328         --------------------------------------------------------------------------------     red flour beetle
6_pfamImport     --------------------------------------------------------------------------------    
Q9W4A6       576 tdlgheeatglvsfenlesldniypaalssnigtlnSTAC--GRIDIMGTI-------------VYDSAPYLYPFIIEYS 640 fruit fly
CAP34165     290 ------------------------------------------NNTPETKTVepaavsrlfalehFGDVATFLTTCIVEYS 327 Caenorhabditis ...
Q22977       291 ----------------------------------------------------------lrslykLGSAANFLLTTMVEFS 312 Caenorhabditis ...
XP_003110541 322 ------------------------------------------PTYSYNSTSnhtllr-mqsmarLGDFSSFLLTCLVEYS 358 Caenorhabditis ...
Q22976       313 --------------------------------------------YPYTNSSnttsllrmqsmvrLGDFSSFLLTCLVEYS 348 Caenorhabditis ...
PDM84064     341 ------------------------------------AHDC--KGVQCL----------------FGEFSEFMYTCVVEYS 366 Pristionchus pa...
XP_002634537 322 ------------------------------------AVECf-----------------------LGSLSEIMFTSIVEYS 342 Caenorhabditis ...
ESN90352     271 -----------------------------------fTIQCfgEETNIFKFL-------------NVSVVPLCYPFMYE-S 301 Helobdella robusta
EFA02328     489 ------------------------------------VSEC--QNDAGLSLI-------------YRNYSPYLYPFSVEYS 517 red flour beetle
6_pfamImport 158 ------------------------------------LKKC--HGPMQFKIV-------------FETFSPYLYPFTIEYS 186
Q9W4A6       641 LIGAVVLYVMW--------------------------------------------------------------------- 651 fruit fly
CAP34165     328 LIGAAIMFILW--------------------------------------------------------------------- 338 Caenorhabditis ...
Q22977       313 LIAAAVYFIVW--------------------------------------------------------------------- 323 Caenorhabditis ...
XP_003110541 359 LIGAAVCFIIW--------------------------------------------------------------------- 369 Caenorhabditis ...
Q22976       349 LIGAAICFIIW--------------------------------------------------------------------- 359 Caenorhabditis ...
PDM84064     367 LICAGVAFVFW--------------------------------------------------------------------- 377 Pristionchus pa...
XP_002634537 343 LIAAAVMYIVW--------------------------------------------------------------------- 353 Caenorhabditis ...
ESN90352     302 CVLLCERFMHWfchckrmsvrtsfkralkqpnqpsvdeetkveddnvtnvlgvnenneitiksdhlsepinenngsfylv 381 Helobdella robusta
EFA02328     518 ILVVGVLFVIW--------------------------------------------------------------------- 528 red flour beetle
6_pfamImport 187 ILVVGVLFIMW--------------------------------------------------------------------- 197
Q9W4A6       652 ----------------------------------------------------------KHIGRYPGr---------mNDE 664 fruit fly
CAP34165     339 ----------------------------------------------------------KSIGQNNHh---------qSNS 351 Caenorhabditis ...
Q22977       324 ----------------------------------------------------------KHEGEQTPq---------dARK 336 Caenorhabditis ...
XP_003110541 370 ----------------------------------------------------------KYMGATSIeen------vdKKK 385 Caenorhabditis ...
Q22976       360 ----------------------------------------------------------KYMGATNIemk------vdKKK 375 Caenorhabditis ...
PDM84064     378 ----------------------------------------------------------TNCGVhgegekidd-------- 391 Pristionchus pa...
XP_002634537 354 ----------------------------------------------------------RNIGRQDHg----------STY 365 Caenorhabditis ...
ESN90352     382 dssndeceldnkefssaedeneledeevitdesdlddhsfhdisdinqeannnndtssKNINQQVYvkscihsevsrEKM 461 Helobdella robusta
EFA02328     529 ----------------------------------------------------------QSIGK-CKq---------kEEM 540 red flour beetle
6_pfamImport 198 ----------------------------------------------------------QNIGThkhcrnddw-------- 211
Q9W4A6       665 dlehrlevmls--------------------------------------rravamaqqaRSGRVDCVGSSKGLFFGL--- 703 fruit fly
CAP34165     352 gk-------------------------------------------------------rkVKMRIDCSSSSTGLFAGI--- 373 Caenorhabditis ...
Q22977       337 -----------------------------------------------------------KHVRFDCKSTSVGIFAAI--- 354 Caenorhabditis ...
XP_003110541 386 -----------------------------------------------------------KKLRMDCTSTTVGLFAGI--- 403 Caenorhabditis ...
Q22976       376 -----------------------------------------------------------KKLRMDCHNTTIGLFLGI--- 393 Caenorhabditis ...
PDM84064     392 ---------------------------------------------------prpqrrkrNIVTIDCSRTAEGLFAGF--- 417 Pristionchus pa...
XP_002634537 366 vk-------------------------------------------------------rkHQIRVDCSKTTTGLFLGL--- 387 Caenorhabditis ...
ESN90352     462 dfhsradnsntaeaqnsscsemfdsatrdnsqqiivadneeannesrrndgqltgkhskRRLSKNISDSDRKMVGSLgca 541 Helobdella robusta
EFA02328     541 sstrqcdtpv----------------------------------------gnndnlesnVVIHADCHSANKGLFSGI--- 577 red flour beetle
6_pfamImport 212 ---------------------------------------------------nsgdlmsnVVLYADCHSSNKGLFAGL--- 237
Q9W4A6       704 LLLVGALICLILFFVLVRHQQFSLLAIYLADA-SHCI--------------LMAFAILAIIVGFIRVKNLKFRCE----- 763 fruit fly
CAP34165     374 IFLIGSLVSMGMYTIFETLRNSSG-AQLVFGI-VDLS--------------LFSIALGACVIGLWRMRLLQYRLH----- 432 Caenorhabditis ...
Q22977       355 VLLIGSFISIAMHYIYNN-SDMPRTADEVIGI-AETV--------------LFCVCLLAVFGAFIRMRKLQYRLH----- 413 Caenorhabditis ...
XP_003110541 404 FFMTAAFVTIGIYTMLYNKKNAAG-ADLVIGI-VNLV--------------LFCVALVAVIFGSWRMRVLQYRLH----- 462 Caenorhabditis ...
Q22976       394 FFMTAAFVTIGIYTMLYNKKKTQS-ADLVIGI-VNLI--------------LFCVTLLATIFGAWRMRVLQYRLH----- 452 Caenorhabditis ...
PDM84064     418 LFLICTILAVSLYNAYSTDA---YMAQLIFLS-TEIF--------------FYGVAIVVCCYAFWRMKVLAFNHDqdend 479 Pristionchus pa...
XP_002634537 388 AFLAVTFTSMVVYYGFTMMNKSKD-AAFVYAF-TDMF--------------QYVLSTIGVLTAIYQMRALKYFNKkthiq 451 Caenorhabditis ...
ESN90352     542 LFFLFTISTNVLFFIFSLLP----GAIQKNDLsAEVKhdvinrlflyytipFYGSIIISVIYGFTVAKDFPLRRSniint 617 Helobdella robusta
EFA02328     578 VIMVLTVVSVILFLIAFNDSRYTEEAVSINSS-TSII--------------ITLLMTITVIFAYRQITKLDVSQS----- 637 red flour beetle
6_pfamImport 238 IVLAGSFLSIILFFVAMADSKYLDVGLSVNSC-TELT--------------LIVLMSLTVVPLYSQITKLDVNRK----- 297
Q9W4A6       764 -EQS-NLNDILLRISAFGLFTYSVFSIIAGSLKVLES--EPSLLVT---------TTGGVAVFQVILQLLFIADVSRRR- 829 fruit fly
CAP34165     433 -AHGeVIDEILLIIGLIGEILYCAVGIDVFITCRRSAdlTVSALPA---------FVFVIRMIQVVVQAAFILTTSRLR- 501 Caenorhabditis ...
Q22977       414 -AHGqVVDEILLIVGLAGEIVYCSTGLDLYLNGRLENtpGTSCLTV---------VAFVMRIVQVVVQSVFILVASRLR- 482 Caenorhabditis ...
XP_003110541 463 -AHGeVIDEILLIIGLVGELVYCSIGFDMIINGRRTGk-NAPNLAI---------AVFTFRIVQVIIQAMYILIASRLR- 530 Caenorhabditis ...
Q22976       453 -AHGeVIDEILLIIGLVGELIYCSIGFDMIVNGNRTGs-HVPNLPI---------AVFTFRIIQVIIQAMYILIASRLR- 520 Caenorhabditis ...
PDM84064     480 eSAE-FLDEILLVVGLLGELVFCLGGLLAFVNQNEIH--ALAVLLF---------VSNFLRLIQVTIQSGLIMIGSRLVl 547 Pristionchus pa...
XP_002634537 452 nSDQeLLDQILLSIGLVGELIYSVAGLVGLTGEKQWT--NFSFVLL---------FVHIFRLIQVGTQT-FLLHVARSV- 518 Caenorhabditis ...
ESN90352     618 fQGL----DYLLFISASGPFAYNVFSLVAAYNK-------PSILVLygmnaigsvVVQVVNILQVYIQIPFCFFAGRV-- 684 Helobdella robusta
EFA02328     638 -HVS-LLDDLLLFGCIPAFFLNGIVSIIPAVIS-------QNATSI---------VLIILEVGQVLVQTPLIIDGLRRC- 698 red flour beetle
6_pfamImport 298 -AVS-LLDDLLLFICIPAFFVQTILIITPAWYA-------ENYVGL---------VTAVLQTVQVLIQTPFISDGLRRC- 358
Q9W4A6       830 -VHLPEHDRSKP----GRQIVTFLLICNVAMFAIYTFEAQKVFAN--PVQLEFYGFVPWSIIQRITLPLCIFHRF 897 fruit fly
CAP34165     502 -CLSKYSIKYKP----GKEIITFLLVSNVTLFVFHTFEGMKSSFGfsSKAATQY-----NYIIYAVGPLLVFYRF 566 Caenorhabditis briggsae
Q22977       483 -SLSASNISNQP----GKQIVTFLVVCNINLFIYHTFETIESNFGfpHKMSSVY-----SALLNISSPLVVFYRF 547 Caenorhabditis elegans
XP_003110541 531 -CLSTANTQYQP----GKQTLTFLVIINISLFVYHAFEGMKSTYGfpSIMESKY-----FELLNISSPLVVFYRF 595 Caenorhabditis remanei
Q22976       521 -CLSEVNARTQP----GKQTLTFLVLINITLFVYHTFEGMKSTYGfpALMETKY-----FELLNISSPLVVFYRF 585 Caenorhabditis elegans
PDM84064     548 dIENPKTIRYKP----GKQVITLLLIINLALFFMNIFEAQKAGVT--DEVVQMYGGRSWALIVRGCSPLTVFYRF 616 Pristionchus pacificus
XP_002634537 519 -RMGCEDREAQP----GKQAITFLLTANLAIFFMNLFESEKAGVS--EIIIEYYGKRSWVFLVRSFSPLTIFYRF 586 Caenorhabditis briggsae
ESN90352     685 -SAVHPNGKKRPksmhFQAVLVHVSVSNATLWLVNSFATTYNNGSv-YYDSEFFGKDLWNIINSFILPITLFFRF 757 Helobdella robusta
EFA02328     699 -SNSKELRREKP----GRELLTFLIVCNVAMWIMQTFEVKSHGLQ--DHKNEFYGEELWTIIGHLCVPLMMFYRF 766 red flour beetle
6_pfamImport 359 -SNTKSLRVQKP----GRELLTFLIVLNVTMWITETFEIKSHTAMdgDPSSRYYGQFLWAVVTHLTFPLTMFYRF 428
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap