6V22


Conserved Protein Domain Family
CaKB

?
pfam03185: CaKB 
Calcium-activated potassium channel, beta subunit
Statistics
?
PSSM-Id: 397343
Aligned: 32 rows
Threshold Bit Score: 239.457
Threshold Setting Gi: 542204762
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6V22_E         8 YEYTEAEDKSIRLGLFLIISGVVSLFIFGFCWLSPALQDLQATEANCTVLSVQQIGEvFECTFTCGADCRGTSQYPCVQV 87 
XP_015216319  77 TALRAGEDRAMLLGISMMGFSVMTYFLLGITVVRSYTESIWTGESNCTVLNSSIVAD-VNCSYSCGSDCWKGSRYPCLQV 155 spotted gar
XP_011472641  36 TALRAGEDRAILLGVSMILLSVMMYFVLGITVLRSYFDSLWTEEDTCTVVNATIVWD-VNCSYSCGAECWKSSRYPCLQV 114 Japanese medaka
XP_003975840  29 TALKPGEDRAILLGLGMILSSVMLYFVLGITILRSYAESVWTEEGVCVVLNATVTAD-VNCSYSCGSDCWRVSKYPCLQV 107 torafugu
NP_001013543  35 TALKAGEDRAILLGLSMVFSSVMMYFVICITMVRAYPDSLLIDETTCTVLNSSLTKE-INCSYNCGSDCWRSSKYPCLQV 113 zebrafish
XP_001508870   7 TAQKRGETRALCLGVVMVFGSVIAYYILGTTLLPLYQKSVWSQVSKCHLIEANIKDQ-------EELDGRNVPQYPCL-- 77  platypus
XP_003756862   7 TAQIRGETRALCLGALMVVCSAITYYILGTTVLPLYHKSVWTKVSNCHLLEADIRDH-------EKLDGKKVPQYPCL-- 77  Tasmanian devil
O93393         8 TAQKRGETRALCLGLGMVACSMMMYFFIGITIVPFYTKSVWTTETICKVLKVNIKDK-ALCSNSEGSEDEDIFHYPCLHV 86  chicken
XP_008102854   8 TAQKRGETRALFLGLGMVACSVIMYFFIGITIVPSYKRSVWTNESMCKLIKATTMEK-VHCLYNEGSGNENIFRYPCLQV 86  green anole
XP_022614881  36 TALRAGEDRAILLGLSMVFFSVMMYFVLGITILRSYSDSVWTDEASCTIVNSTIMWD-VNCSYSCGAECWRSSRYPCLQV 114 greater amberjack
6V22_E        88 YVNNSESNSRALLHSDEHQLLTNPKCSYIPPCKRENQKNLESVMNWQQYWKDEigsQPFTCYFNQHQRPDDVLLHRTHDE 167
XP_015216319 156 FVMLNSSGKAARLSHNEEMQELNPECFFVPKCRKDYSVAQTIIRNISERLKVH---QHFPCYYDPGEGQASVLLTRLHGR 232 spotted gar
XP_011472641 115 FVSLNSTEKVVRLLHNEDTQDNNPECFYIPKCHKNYASTRAIVESICERLRSQ---HTLHCFVDPTNQTESAILTQFYSR 191 Japanese medaka
XP_003975840 108 YVSLNNTGRVSRLSHNEETQDSSSECFYVPRCQKDSAAMHVVIMNISERLKVN---TQVTCYYDPSEQQETVLLTRLYDH 184 torafugu
NP_001013543 114 YVSLNATGRIGLLSHNEEMLDVSSECFYVPKCQKDHTAMRVLIQNISDHLKMQ---QQVRCFHDPSEHQASILLKRIYGS 190 zebrafish
XP_001508870  78 WVNVTALGKWAMLYHTEETKEKNHQCSYIPTHLENYRKARLDVEKIKANFKEH---QAFLCYHDPEENERSVLYTRLYGP 154 platypus
XP_003756862  78 WVNVSATGKSAILYHTEETKEKNRQCSYIPESLEDYQEARIDVETIRGRFKEH---QTFPCYSDPEEIERSVLLRRIYTP 154 Tasmanian devil
O93393        87 WVNLTASGQEVMLYYTEDTLERNPKCSYVPGNSENAKEVKAKIEEIANNFKKY---QTFPCYYDPGGMQTNVILSRLYPP 163 chicken
XP_008102854  87 QVNLTLLGQVVKLYHTEDTADRNPKCFYVPENMENYSEVEKLVKTITDNFRKH---QTFSCYYDPSRKEESAILKRLYPP 163 green anole
XP_022614881 115 YVSLNSSGKVVRLLHNEETQDSNPECFYIPKCRKDYAATHAIIQNISERLRSQ---HTVQCFMDPTDRTDSAILTQIYGR 191 greater amberjack
6V22_E       168 IVLLHCFLWPLVTFVVGVLIVVLTICAKSLAVKAEA 203
XP_015216319 233 RAVLLSLLWPSCTLLGGALIVALVKLTQHLSILCEH 268 spotted gar
XP_011472641 192 VAVFHSLFWPTCTLVGGTIIIAMVKLTQNLSIMSER 227 Japanese medaka
XP_003975840 185 GVLFHSLLWPSCMLAGGALIIMMVKLTQYLSRLCEE 220 torafugu
NP_001013543 191 ASLLHSLFWPSCMLSGGTLIILMVKLTQYLSILCEQ 226 zebrafish
XP_001508870 155 QVLFSSLFWPTFMLIGGVLIIIMVKINQSLSVLVAQ 190 platypus
XP_003756862 155 QTLFKWLFWPTFMLTGGIFIIMMVKINQALSMLAAQ 190 Tasmanian devil
O93393       164 RGLLFTFLWPTLMFTGGCLIIVLVKISQYVSVLSAR 199 chicken
XP_008102854 164 EGLILAFVWPSLMLFGGVLVIIMVKISQYISVLSAs 199 green anole
XP_022614881 192 VAVFHSLFWPTCTLIGGTLIIAMVKLTQYLSIMCER 227 greater amberjack
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap