4GOT,4YAH,1XS5,4K3F


Conserved Protein Domain Family
Lipoprotein_9

?
pfam03180: Lipoprotein_9 
Click on image for an interactive view with Cn3D
NLPA lipoprotein
This family of bacterial lipoproteins contains several antigenic members, that may be involved in bacterial virulence. Their precise function is unknown. However they are probably distantly related to pfam00497 which are solute binding proteins.
Statistics
?
PSSM-Id: 397341
Aligned: 30 rows
Threshold Bit Score: 265.274
Threshold Setting Gi: 122540172
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4GOT_A   8 IVVAATKTPHAEILK--EAEPLLKEKG-YTLKVKVLSDYKXYNKALADKEVDANYFQHIPYLEQEXKEnTDYKLVNAGAV 84  Bacillus subtilis sub...
Q9I1C9  26 LKIGTT-AAFAPPLE--VAVSEAGKQG-LKVELVEFSDWNAPNITLAQGDIDANYFQHVPFLENANRE-GGFQLKPFAPG 100 Pseudomonas aeruginosa
Q9CIN7  40 VKIGIMTGTKEDDSIwqTVSKTAKDKYgITLKFTHFTDYTQPNTALKNGDIDLNAFQHYAFLKAWNKA-NNGNLVAIGDT 118 Lactococcus lactis su...
Q9CIN8  40 VNIGIMTGTKEDDAIwsTVSKTAKDKYgITLKFTHFTDYTQPNTALKNGDIDLNAFQHYAFLNAWNKA-NDGDLKAIGNT 118 Lactococcus lactis su...
Q9CIN5  41 VKIGLMPGGKQEDAIwkQVQKIAKDQFgITLKFVNFTDGDQPNKALANHEVDLNAFQHYAYLKSWNKA-NNGNIVSIGDT 119 Lactococcus lactis su...
Q9CIN6  40 VKVGIMSGDKQDQEVwkSVAKTAKEKYdLKLKFVYFSDYNQPNEALLSGDIDVNAFQSYNYVKTWNKA-HKSDIVAVGNT 118 Lactococcus lactis su...
Q2G0V0  26 VTIGVASNDTKAW-E--KVKELAKKDD-IDVEIKHFSDYNLPNKALNDGDIDMNAFQHFAFLDQYKKAhKGTKISALSTT 101 Staphylococcus aureus...
P54594  29 IKIGIAESDGAIWNY---IAQKAEEAG-LDIQLIPFSDYAESDIALANKEIDANAFQTISYFQSFTEK-YKLNLAPLGTT 103 Bacillus subtilis sub...
Q9S4Z1  32 IVFGVAPGPYGDMVKq-AIAPTLKEKG-YKVVVREFSDYVQPNMALANGSIDANLFQHTLYFDKFTAD-KGLKLSKLIVV 108 Salmonella enterica s...
Q7DD63  45 IVFGTTVGDFGDMVKe-QIQAELEKKG-YTVKLVEFTDYVRPNLALAEGELDINVFQHKPYLDDFKKE-HNLDITEVFQV 121 Neisseria meningitidi...
4GOT_A  85 HLEPFGIYSKTYKSLKDLPDGATIILTNNVAEQGRXLAXLENAGLITLDskvETVDATLKDIKKNPKNLEFKKVAPELTA 164 Bacillus subtilis sub...
Q9I1C9 101 IINNVGLYSKRYASLAELPEGASVAIANDPINGGRGLQLLQKAGLLKLRd-gVGYKATLDDIVDNPKDIRITELEAVQLA 179 Pseudomonas aeruginosa
Q9CIN7 119 VISPISVYSKQLKNISDIKEGGTIAVPNDASNESRALYVLKSAGLIKLDvs-gQTLATVKDITSNPKNLVIKELDASQTA 197 Lactococcus lactis su...
Q9CIN8 119 TISPIRLYSKKITSLSQIKSGDTIAVPNDASNESRALYVLKNAGLIGLSvs-gDTLATVKDINSNPKNLVIKELDAAQTP 197 Lactococcus lactis su...
Q9CIN5 120 IITPIHLYSTKYKNVTEIPDKSTIAIPNDVTNESRALYVLKNAGLIKLDt-sRGALATVKDIRDNPKGLIIKEIDASQTP 198 Lactococcus lactis su...
Q9CIN6 119 YITPMHIYSKEVSKLSDLKEGSTVAIPNDASNESRALFVLQSAGLIKLTtsdSSKLVGLPDITENPHQLKFKEVDASQTP 198 Lactococcus lactis su...
Q2G0V0 102 VLAPLGIYSDKIKDVKKVKDGAKVVIPNDVSNQARALKLLEAAGLIKLKk-dFGLAGTVKDITSNPKHLKITAVDAQQTA 180 Staphylococcus aureus...
P54594 104 YITPMGIYSKRYERIRDISRGAVVSVPDKAFDFGRALTVLQEAGLLTLKn-gFNGTGSVDMIKDNPRHLKLK---AVRQQ 179 Bacillus subtilis sub...
Q9S4Z1 109 PTAGMGFYSRKINSLDALKKGDIITLSNDPTNLARGLRFLQSLGLITIKdniDPTKASERDIASNPKGLVFKPLEAAQLP 188 Salmonella enterica s...
Q7DD63 122 PTAPLGLYPGKLKSLEEVKDGSTVSAPNDPSNFARVLVMLDELGWIKLKdgiNPLTASKADIAENLKNIKIVELEAAQLP 201 Neisseria meningitidi...
4GOT_A 165 KAYEnkeGDAVFINVNYA-IQNKLNPKKDAIEVEsTK-N---NPYANIIAVRK-GEEDSAKIKALXEVLH-SKKIKDFIE 237 Bacillus subtilis sub...
Q9I1C9 180 RALDd--FDLAQGYPHYLrLAGTIDPTRALLFDGiDN-----REYVIQFVTRGdYQDRDGRLARFVDIYQhSPVVRAALD 252 Pseudomonas aeruginosa
Q9CIN7 198 RALDs--VDAAVINNNYA-VTAGLKKSDAIFTEPvNKdS---QQWINIIVANK-KDENNTVYKDVVKAYE-TEATKKTIA 269 Lactococcus lactis su...
Q9CIN8 198 RALDs--ITAAVINDDFA-TTAKLTVEESIYTEPvNKdS---EQWINIIVANK-KDANNKIYKEVVKAYQ-TEATKKAIE 269 Lactococcus lactis su...
Q9CIN5 199 RALDs--VAAAVINYNFA-ISAKISEKESIYQEPlNEdS---AQWINFIAANQ-SDKNNKVYKEVVKAYE-QKNIADSIK 270 Lactococcus lactis su...
Q9CIN6 199 RALDs--VALSVVNYNYA-TAASLPNSESVYMEPlNKtS---AQYINFIAATS-KEKNNKVYKEVAKAYA-SKATEKAIK 270 Lactococcus lactis su...
Q2G0V0 181 RALSd--VDIAVINNGVA-TKAGKDPKNDPIFLEkSN-SdavKPYINIVAVND-KDLDNKTYAKIVELYH-SKEAQKALQ 254 Staphylococcus aureus...
P54594 180 DAVSg--ADVFVMKPSEA-KKAGLNPKKHTLKSGgLM-S---EEEMNLIVVRA-EDQDREALQTILELYQ-ADDTAAFIE 250 Bacillus subtilis sub...
Q9S4Z1 189 RTLDg--VTGALVNGNFA-VAAGLDLSSAIKQEH--L-D---ENLKNIIAVRS-EDADKPFAKDIVEAVK-SPAYRAVID 257 Salmonella enterica s...
Q7DD63 202 RSRAd--VDFAVVNGNYA-ISSGMKLTEALFQEP----S---FAYVNWSAVKT-ADKDSQWLKDVTEAYN-SDAFKAYAH 269 Neisseria meningitidi...
4GOT_A 238 KK---Y-DGAVLPVS 248 Bacillus subtilis subsp. subtilis str. 168
Q9I1C9 253 KAh----GTLYQPGW 263 Pseudomonas aeruginosa
Q9CIN7 270 KAy---pDKSTIPAW 281 Lactococcus lactis subsp. lactis
Q9CIN8 270 KAy---pDKRKIAAW 281 Lactococcus lactis subsp. lactis
Q9CIN5 271 KE---YpDGGELPAW 282 Lactococcus lactis subsp. lactis
Q9CIN6 271 EQ---YpDGGELPAW 282 Lactococcus lactis subsp. lactis
Q2G0V0 255 ED---V-KDGEKPVn 265 Staphylococcus aureus subsp. aureus NCTC 8325
P54594 251 KE---Y-QGDLVPAF 261 Bacillus subtilis subsp. subtilis str. 168
Q9S4Z1 258 DPkniY-SAFQKPEW 271 Salmonella enterica subsp. enterica serovar Typhimurium
Q7DD63 270 KR---F-EGYKSPAa 280 Neisseria meningitidis serogroup B
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap