3J9T


Conserved Protein Domain Family
V-ATPase_G

?
pfam03179: V-ATPase_G 
Click on image for an interactive view with Cn3D
Vacuolar (H+)-ATPase G subunit
This family represents the eukaryotic vacuolar (H+)-ATPase (V-ATPase) G subunit. V-ATPases generate an acidic environment in several intracellular compartments. Correspondingly, they are found as membrane-attached proteins in several organelles. They are also found in the plasma membranes of some specialized cells. V-ATPases consist of peripheral (V1) and membrane integral (V0) heteromultimeric complexes. The G subunit is part of the V1 subunit, but is also thought to be strongly attached to the V0 complex. It may be involved in the coupling of ATP degradation to H+ translocation.
Statistics
?
PSSM-Id: 397340
Aligned: 25 rows
Threshold Bit Score: 86.8857
Threshold Setting Gi: 12585426
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3J9T_H     2 SQKNGIATLLQAEKEAHEIVSKARKYRQDKLKQAKTDAAKEIDSYKIQKDKELKEFEQKNAGGVGELEKKAEAGVQGELA 81  baker's yeast
Q75F04     2 SQSNGIATLLKAEKEAHEIVASARRYRQERLKQAKLDALQEINEYRRRKEQELREYEAANAGGAEELERDAEQRAQKELD 81  Eremothecium gossypii
Q6FTT6     2 SQKNGIATLLKAEKEAHEIVTEARKYRQEKIKQAKLDASKEIENYKAKKEQELKDFESNNAGGVQELEKKADAEVQSELD 81  [Candida] glabrata
Q5KFF8    18 aNSQGIQTLLEAEKEAAKVVQKARQYRVQKLKDARSEAAKEIEAYKAKKEEEFKRFESEHISRTSTSQTSIDSTTKTQLS 97  Cryptococcus neofor...
KIS67241   4 QQSQGIQTLLEAEKEAAKIVQKARTYRTQKLKDARSEASKEIEQLKSNKEKEFNDFQKEHEGSTSSSQTTVDKETEQKLE 83  Ustilago maydis 521
Q2U269     4 QNSAGIQTLLDAEREAQKIVQQVLD-RTKRIRDAKSEAQKEIEEYRNQKEQEFKKFEAEHSSGYKKAEEDANKEAEVKLQ 82  Aspergillus oryzae
P78713     4 QKSAGIQLLLDAEREATKIVQKAREYRTKRVREARDEAKKEIEAYKAQKEAEFKKFEAEHTQGNQAAQEEANAEAEARIR 83  Neurospora crassa O...
O74174     4 QTNSGIQQLLEAEKVARNIVEKARQHRTQRLKDARLEAKREIDEYASKKEEEFKKSESQASGIYSQAEAESKKQVQDTFA 83  Schizosaccharomyces...
Q9SZH0     5 RGQGGIQMLLTAEQEAGRIVSAARTAKLARMKQAKDEAEKEMEEYRSRLEEEYQTQVSGT--DQEADAKRLDDETDVRIT 82  thale cress
Q54Z13     2 SSEDGIKKLLDAERTAQKIVADARQDRVQKLKKAVEEAEKEIKEFREKKDKEYKEYESKYLGASSETASQLATNANKEID 81  Dictyostelium disco...
3J9T_H    82 EIKKIAEKKKDDVVKILIETVIKPS 106 baker's yeast
Q75F04    82 EIRRVAGAKRDAVVELLIDAVTKPQ 106 Eremothecium gossypii
Q6FTT6    82 EIKKTVESKKKQVVDLLLEAVTKPT 106 [Candida] glabrata
Q5KFF8    98 ELDDAVAKNKEEVVKKIVSRVLQSk 122 Cryptococcus neoformans
KIS67241  84 ELNKAFDANRDQVIAKLLDRVVDVK 108 Ustilago maydis 521
Q2U269    83 EIKDAGNSKGAKVVEDLISALTDVK 107 Aspergillus oryzae
P78713    84 EIKEAGNKNREQVIKDLLHAVFTPS 108 Neurospora crassa OR74A
O74174    84 SIETSSQKNSDKVVDAILSITCNVK 108 Schizosaccharomyces pombe 972h-
Q9SZH0    83 NLKESSSKVSKDIVKMLIKYVTTTA 107 thale cress
Q54Z13    82 TIRNETAANKQKVVDLLIKYAITCD 106 Dictyostelium discoideum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap