5IY6


Conserved Protein Domain Family
TFIIA

?
pfam03153: TFIIA 
Transcription factor IIA, alpha/beta subunit
Transcription initiation factor IIA (TFIIA) is a heterotrimer, the three subunits being known as alpha, beta, and gamma, in order of molecular weight. The N and C-terminal domains of the gamma subunit are represented in pfam02268 and pfam02751, respectively. This family represents the precursor that yields both the alpha and beta subunits. The TFIIA heterotrimer is an essential general transcription initiation factor for the expression of genes transcribed by RNA polymerase II. Together with TFIID, TFIIA binds to the promoter region; this is the first step in the formation of a pre-initiation complex (PIC). Binding of the rest of the transcription machinery follows this step. After initiation, the PIC does not completely dissociate from the promoter. Some components, including TFIIA, remain attached and re-initiate a subsequent round of transcription.
Statistics
?
PSSM-Id: 397322
Aligned: 64 rows
Threshold Bit Score: 126.655
Threshold Setting Gi: 510999865
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5IY6_N         13 LYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQqlllqvqqqhqpqqqqhhhhhhhqqaqp 92  
NP_001191795   10 LYKSVIEDVIESIQGLFAEEGVDKQVLRNLKELWETKVMQSKATEGLFKHSH---------------------------- 61   chicken
AAI57264       13 LYKSIIEDVMESVRELFVEEGVDEQVLKDLKQLWETKVLQSKATEGFFRDN----------------------------- 63   tropical claw...
XP_014345874   13 LYRSIIEDVIDGVQELFVEEGIDDQVLKELKQRWESKVIHSKAMEGFFRDHS---------------------------- 64   coelacanth
9_pfamImport    1 LYLSIIDDVIESMRELFTDEGLEDRVLDDLRQIWESKMMQSKAMEDYRKSNI---------------------------- 52  
XP_019222217    4 LYLSIIDDVIDSVRELFLDEGVEDRVLDDLRHLWESKVMQSKAMEGLRKNT----------------------------- 54   Nile tilapia
XP_011601748  691 VYLSIIDDVIESIRELFLDEGLEDRLVDHLRHLWESKMMQSRAIEDLRKGIV---------------------------- 742  torafugu
XP_014345875    1 ----------------------mahsvhfnlvRWESKVIHSKAMEGFFRDHS---------------------------- 30   coelacanth
XP_030124702   18 LYMSIIEDVIEGVRELFAEEGVEEQVLKDLKQLWETKVAQSKATEGFFKHSR---------------------------- 69   zebra finch
XP_031454381   10 LYKSIIDDVIESIQDLFAEEGIDKQVLRNLKELWETKVMQSKATEGLFKHRH---------------------------- 61   Ring-necked p...
5IY6_N         93 qqTVPQQAQTQQVLIPASQQATAPQVIVPDSKLIQhMNasN----------------------------------MS--A 136 
NP_001191795   62 --HSSHLTVQFPHNFHHVLQASTASFVIPTGGGFQhFMa-Ad--------------------------------lGA--S 104  chicken
AAI57264       64 --SAPQFVLQLPQNLHHSLHSSTGN------RNVThFSt-Ge--------------------------------mGT--S 100  tropical claw...
XP_014345874   65 --HSPQFVLQLPQNYHPALQKSADSIVIPASKSVQsYTt-AdltcndgytyervdgskffrvkrdcqnwrsatikSS--S 139  coelacanth
9_pfamImport   53 --NSSNFVLQLPANYNRTNQELTASVVIPASQNIRsFPm-Kem-------------------------------qNN--S 96  
XP_019222217   55 --NPSNFVLQLPASYTQTDQELTASVVIPGNQNIRsFP--Vk---------------------------------NN--S 95   Nile tilapia
XP_011601748  743 --NPANFLLQLPanyrradqeaaaSVVIPSSQNIHgFS--R----------------------------------LKnnS 784  torafugu
XP_014345875   31 --HSPQFVLQLPQNYHPALQKSADSIVIPASKSVQsYTt-AdltcndgytyervdgskffrvkrdcqnwrsatikSS--S 105  coelacanth
XP_030124702   70 --CSPRFSLQLPHGSHSILQTSAASYVIQAGRGFQhFTa-Akl-------------------------------gSP--R 113  zebra finch
XP_031454381   62 --HSSHLTLQVPQNFHHVLQAPAASLVIPTGGGFQhFMa-Ad--------------------------------lGA--S 104  Ring-necked p...
5IY6_N        137 aATAATL--ALPagvTPVQQIltN------SGQLLQV-V----RAANGAQYIFqpqqsvvlqqqvipqmqpggvQAPVIQ 203 
NP_001191795  105 -QKGATL--TFPssvAYPIHVpaGltlqtaSGQLYKVnMpvmvAHGQGDASIL---------------------QHPLQQ 160  chicken
AAI57264      101 -GSNSAF--SLPagiTYPIHLpaGmtvqtaSGQLYKVtVpvmvTQAPGGPRIL---------------------QPPVQQ 156  tropical claw...
XP_014345874  140 -GTNTTF--TLPagiSYPVQIpaGvtlqtaSGHLYKVnVpvmvTQAPGGSRMF---------------------QQPIPQ 195  coelacanth
9_pfamImport   97 -GILPTF--SLPaglSYPVQIpaGvtlqtaSGQLYKVnVpvvvTQAPAGQPPV---------------------SRLAQV 152 
XP_019222217   96 -ETLATF--SLPaglAYPVQIpaGvtlqtaSGQLYKVnVpvvvTQAPVGQQPA---------------------TQAMQK 151  Nile tilapia
XP_011601748  785 -ETLATF--SLPaglSYPVQIpaGvtlqtaSGQLYKVnVpvvvTQSAAGQQAA---------------------AQQTHK 840  torafugu
XP_014345875  106 -GTNTTF--TLPagiSYPVQIpaGvtlqtaSGHLYKVnVpvmvTQAPGGSRMF---------------------QQPIPQ 161  coelacanth
XP_030124702  114 -VGVTLAvpSCV---AYPLQMptGvmlqpaPGQLYKVnVpivvTQASGDASIL---------------------HYPVQQ 168  zebra finch
XP_031454381  105 -QKGATL--TLPssvAYPIHVpaGltlqtaSGQLYKVnMpvmvAHGQGDASIL---------------------QHPLQQ 160  Ring-necked p...
5IY6_N        204 qvlaplpggispqtgviiqpqqilftgnktqvip---------------------------------------------- 237 
NP_001191795  161 vfqpigqpsvlktnlatvapvrtssvqataeilqtqktevqqtvvfqpsafhnkhpenstntvlfqqpavsqqeiatnav 240  chicken
AAI57264      157 ffqhirhpsghaassqysrnayieqkwqqqpaqvhsseglniydqeatiepnyqnnnnddliiqqsidlqqnltnkglhq 236  tropical claw...
XP_014345874  196 mfqqlshsagqsaaiqsstvpvqralqqqaeslhqpisgqdldkhvmlgqstqsdkttsqsaihqpiliqqpvvlnqvfi 275  coelacanth
9_pfamImport  153 ierrespdppstaappdasrppqeaealsapaispppphpktnfppgeesalpqqplvppaeasqppgahfpqpeappge 232 
XP_019222217  152 vtewreasapqppaippnpipphevetssvpaqsvtqpktilpssqegslplqstepdfpqeenepnpqpnlstta---- 227  Nile tilapia
XP_011601748  841 isawkeasaaqlaaissyptrhqevepssvqapsvtppsavqpntgspssqestlpvlppvapaeapqlkdlqapeqqva 920  torafugu
XP_014345875  162 mfqqlshsagqsaaiqsstvpvqralqqqaeslhqpisgqdldkhvmlgqstqsdkttsqsaihqpiliqqpvvlnqvfi 241  coelacanth
XP_030124702  169 mfhplgqasvlqaslasvtqlnasaahaagetlqqpqetavqqavlfkpsyvekqhqetsatlvqqpsvslqefeinavl 248  zebra finch
XP_031454381  161 ifqpigqpsvlktnvasvapvrtssvqataetlqtqktevqqtvvfqpstlqnkhpenstnivlfqqpavsqqeiatnav 240  Ring-necked p...
5IY6_N            --------------------------------------------------------------------------------     
NP_001191795  241 lnqcaelteksqysnlhtavftsgssevfspaeslandpgsvllpdvegqldmkpqesvqqqvsggiieliikgksldgn 320  chicken
AAI57264      237 ptnslegsnlneit------------gtlfsprqsnggidlnsesvmnnlnmahslqgqpeneyasllksqdsddvveli 304  tropical claw...
XP_014345874  276 qqnersknhpnesvetpai-sqqseiqqesnvitsqssglhsvlqepvatspypvvqqeesdgieevillddegeksitn 354  coelacanth
9_pfamImport  233 sepnpp----------------------------pepatlcasaspcsqlldfqisteealtqtgqlrtndlddilkevi 284 
XP_019222217  228 --------------------------------------------spctqlldfqirreealaqmaqsrdiddilkeviee 263  Nile tilapia
XP_011601748  921 ldknep---------------------------asqtealnhstnespcsqlldfqistsepltqaeqskssdiddilkr 973  torafugu
XP_014345875  242 qqnersknhpnesvetpai-sqqseiqqesnvitsqssglhsvlqepvatspypvvqqeesdgieevillddegeksitn 320  coelacanth
XP_030124702  249 nqcsestekfqhdnvh--------tavftpecseglfideslassssnvlldvegqlymehpellqqqvpddiidliiag 320  zebra finch
XP_031454381  241 lnqcaelteksqysnvhtavftsgssvvfspaeslandpgsvllpdvegqldmkpqesvqqqvsddiieliikgkslddn 320  Ring-necked p...
5IY6_N        238 -----ttvaaptpaqaqitatgqqqpqaqpaqtqaplvlQVDGTGDTSSE------------------------------ 282 
NP_001191795  321 aalkdqdseaptdkmepteqvesdlqsekgicsdtegiiQLDGTCDGSPKkevlhtkdteenefidi-iesedlkilede 399  chicken
AAI57264      305 lmdnelgdktstgdsgnvgiqtgisnvekqavpreieiiQVDGTGDTSSDedlgnvrdldendfl------giidtedlk 378  tropical claw...
XP_014345874  355 eqtcpkqnasellkmqlltpeasnrtlnedshnddqdiiQVDGIYDTSSDeeavneqdvnenefl------giidaedlk 428  coelacanth
9_pfamImport  285 eeergkavmarktvnqsdadlgvikldlaynyselsdivQLDGAAGNSDMeeeaavsledndfl-------giinaeaik 357 
XP_019222217  264 erekaerakklapvesdsqseatlgldldysysqfsdivQLDGPAGNSDLeeeeevpleendfl-------giinaeamk 336  Nile tilapia
XP_011601748  974 vieeeqekaekaraaaktdsqseevlrlvysysdlsdivQLDGAADNTDSee---------------------------- 1025 torafugu
XP_014345875  321 eqtcpkqnasellkmqlltpeasnrtlnedshnddqdiiQVDGIYDTSSDeeavneqdvnenefl------giidaedlk 394  coelacanth
XP_030124702  321 esldensflkdrgsmafsdktesdlplekdlcsdiegisQLDGPGDVSSKeqipqtkdkeenelicfidsedlrvldded 400  zebra finch
XP_031454381  321 talkdqdseaptdkmepteqvesdlqseggicsdtegiiQLDGTCDGSPKkeglhtkdteenefidi-iesedlkilege 399  Ring-necked p...
5IY6_N        283 -----EDedeeedydddeeedkekdGAEDGQVE---------------------------------------EEPLNSED 318 
NP_001191795  400 edeeaDS------------------ISNSESSSscdneep--------------------------qtdvveEDPLNSDD 435  chicken
AAI57264      379 aleedDT------------------ASN-DSTSnssdded-------------------------peidvieEDPLNSGD 414  tropical claw...
XP_014345874  429 aleegIS-------------------SSEDSASsnsedee-------------------------cqveiveEDPLNSGD 464  coelacanth
9_pfamImport  358 alqegGG------------------SSDCNSISsssdeeaa-----------------------deltnvedEDPLNSGD 396 
XP_019222217  337 alqegNE------------------SSDGNSIStssdgega-----------------------delanieeEDPLNSGD 375  Nile tilapia
XP_011601748 1026 ----eET------------------GALEENDFlgminaeaikalqegevssddtsgstsgdsadelasvedEDPLNSGD 1083 torafugu
XP_014345875  395 aleegIS-------------------SSEDSASsnsedee-------------------------cqveiveEDPLNSGD 430  coelacanth
XP_030124702  401 ydeecDS------------------SSNTESSYsdgdned-------------------------lqtdiveEDPLNSGD 437  zebra finch
XP_031454381  400 edeeaDS------------------ISNSESSSscdneep--------------------------qtdiveEDPLNSDD 435  Ring-necked p...
5IY6_N        319 DVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW 376 
NP_001191795  436 DVSDLDIADLFDTNNVIVCQYEKIHRSKNKWKFFLKDGVMSFNGKDYVFAKAVGDAEW 493  chicken
AAI57264      415 DVSEQEVPDLFDTDNVIVCQYDKIHRSKNKWKFYLKDGVMSFGGKDYVFSKAIGEAEW 472  tropical clawed frog
XP_014345874  465 DVSEQDVPDLFDTDNVIVCQYDKIHRSKNKWKFYLKDGVMCFGGKDYVFSKAVGEAEW 522  coelacanth
9_pfamImport  397 DVVEQDIPDLFDTDNVIVCQYDKIHRSKNRWKFHLKDGVICYGGRDYVFSKAVGEAEW 454 
XP_019222217  376 DVIEQDIPDLFDTDNVIVCQYDKIHRSKNRWKFHLKDGVMCYGGRDYVFSKAVGEAEW 433  Nile tilapia
XP_011601748 1084 DVIEQDIPDLFDTDNVIVCQYDKIHRSKNRWKFHLKDGVMCHRGRDYVFSKAVGEAEW 1141 torafugu
XP_014345875  431 DVSEQDVPDLFDTDNVIVCQYDKIHRSKNKWKFYLKDGVMCFGGKDYVFSKAVGEAEW 488  coelacanth
XP_030124702  438 DVSEQDIADLFDTDNVIVCQYEKIHRTKNKWKFYLKDGVMSIEGKDHVFSKATGDAEW 495  zebra finch
XP_031454381  436 DVSDLDIADLFDTNNVIVCQYEKIHRSKNKWKFFLKDGVMSFDGKDYVFAKAVGDAEW 493  Ring-necked pheasant
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap