Conserved Protein Domain Family
Tektin

?
pfam03148: Tektin 
Tektin family
Tektins are cytoskeletal proteins. They have been demonstrated in such cellular sites as centrioles, basal bodies, and along ciliary and flagellar doublet microtubules. Tektins form unique protofilaments, organized as longitudinal polymers of tektin heterodimers with axial periodicity matching tubulin. Tektin polypeptides consist of several alpha-helical regions that are predicted to form coiled coils. Indeed, tektins share considerable structural similarities with intermediate filament proteins. Possible functional roles for tektins are: stabilisation of tubulin protofilaments; attachment of A and B-tubules in ciliary/flagellar microtubule doublets and C-tubules in centrioles; binding of axonemal components.
Statistics
?
PSSM-Id: 397319
Aligned: 140 rows
Threshold Bit Score: 186.978
Threshold Setting Gi: 156352206
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ESN92457      16 WKANQMNVLLGAELDRASAerLTNETKRYIDEMRQASQHSDQRAEFSQERRMEEVRYWQNELNMKLDQIKL--------- 86  Helobdella robusta
CDS43459     116 WFDSYNRLLQANDLAQKNSdcLALDSKRLKGELADRAKTNQNDSTRRLGDRICDTAFWQSEVDSEIAKMKQ--------- 186 Echinococcus mu...
XP_009028491   6 WKVSNGSLLNASDRIKAGSelMRAEALRVCEDACEKTRKGSRDVTKRLDDRAKDIDHWKKELEKELNDLVN--------- 76  Helobdella robusta
XP_005055911  98 WHRSNMTNYKESETTRHNAerLRADLNRAIKDVYQQAKRSQGESTRNLGERVNDIEYWKSELCVELDAMIR--------- 168 Collared flycat...
XP_006635248  97 WHKSNQSNYRESESSRHSAerLRRDTTRLIQDKEQLTRRNQESTNKNIGERINDIAFWRSELTHETGNMIG--------- 167 spotted gar
ESN99582      68 WRMLNEKHCKRSISERNSArkLADEVIDIVKVIDHETKQRQLISTHSLGARISSLSYWKEKLNKEIVLMRNimyelsvsg 147 Helobdella robusta
CAP32895     233 CNIFRTEYDDPIEIVR--------MARLAVKEANMRATRMQGQTTQQLMQRVKDLKYWSGEIDRELADVKE--------- 295 Caenorhabditis ...
XP_001622655  12 WKNASVRNIRLGQTVVNRSdkAC-DMGQQLDPLPSLRDTSIQQSNARIHAYVRATRAVLVKLQENLLDTNE--------- 81  starlet sea ane...
XP_001697824  36 WTLESVEQMGLGATENRMSstLRDASSQLQAVASATVANDISIVDRALTTKLSQTESLKNMLETCLAEVIS--------- 106 Chlamydomonas r...
XP_006637346  92 WRRANTAHLRQSEASRRQAekMRAETSRLIQVQDQLTRKAQSETSRRIGERMTDIAFWTNELSYEVEQLVR--------- 162 spotted gar
ESN92457      87 -AINDLSSIDRRLDKAMDSIKENCHIVHKCLEARKRRKRI-YLVYDPAEKQLCKEREIIEGVLALHCKTKSQVNDQLRLL 164 Helobdella robusta
CDS43459     187 -DIDDLIRARRVTEKLLAETENHLHVTQECLYNREKRQCT-DLVHDDVEKRLIEEVNTVRCIQDELRRLTDNAKTQEQLN 264 Echinococcus mu...
XP_009028491  77 -ETKNLEKIENCVSNALAYTDMPLEMILKCIEERKNRKEI-EMVDDDVDEELRKELENIQSVRSALGNHLFDVQGQLQRN 154 Helobdella robusta
XP_005055911 169 -ETNSLADMQKRLERALADTEGPFQVAHKCLLHREKRMGI-DLVNDDVEKQLVTEIKIIKSCRERLQQCLDTVNAQLMCN 246 Collared flycat...
XP_006635248 168 -EINTLTDVKKRLERALAETEGPLQVAQECLYHREKRMSI-DLVHDEVEQDLLKEVEMIKSCQERMRRHLDRVNAQLASN 245 spotted gar
ESN99582     148 lTVKSFATSQMNLERHLESITCPLIISLKCLDERQKRIGI-DAIRDKVENNLYKEIDTLKKCQRRLKDLSTKAEEQLKTS 226 Helobdella robusta
CAP32895     296 -EHDDLLRCYRRLQLCLDITGRATRCNESCLAVRRKKVQVgDHTSDRVDMELHKEKELMSETVKQMKEVGERVERQLEVN 374 Caenorhabditis ...
XP_001622655  82 -EIKSLIKGKETLEKTLEHIRKDIVLNNKSTSIRKTRPPR-EKSPDGADDLLTAERKHLLKLKRILEAQLRSAQKQLQVL 159 starlet sea ane...
XP_001697824 107 -EIAELLSTKKRLEERNGKVQAKIGVNSNRMQVRSSRPPR-EMTMDEVEKGLIKQQGMLGSFSDRVARAVAQVDREVAQL 184 Chlamydomonas r...
XP_006637346 163 -DSEMLKGVKTRLEKALSVTEGPKQMAKECLYHRQKKLGN-ELITDTVEKELVQEVSVIASCQEQIQRLIDKTMKQLETN 240 spotted gar
ESN92457     165 RKLRHDIEKDVLMKLTNFDVEMESSEIRAKKAAIAA--YNYDPNCEG-------AELcpckleghccqktkkpgglssIS 235 Helobdella robusta
CDS43459     265 RAALHDLEADKARKFRAIQLDESAHSMHNSSAHISY--YEGVECIDQt------QSV---------------------PE 315 Echinococcus mu...
XP_009028491 155 KHIQNLLSDNIMDKHRANVIDKKCRDMKNTSANLKF--PPGIESANTt------ISD---------------------PQ 205 Helobdella robusta
XP_005055911 247 KEARQELEKDLADKQMGHHIDSKCYQLKDTSRDIHF--FKGVERIDAt------VSV---------------------PE 297 Collared flycat...
XP_006635248 246 RAAQHELERDVNDKAEAHRIDDKCHQLRNTSDGISY--YRGVERLDPs------LSI---------------------PD 296 spotted gar
ESN99582     227 TTALEALERDVRNKTHAQKLDSEMYQLHNKV-----------EKLNSselidnmTTAfs------------------hPL 277 Helobdella robusta
CAP32895     375 QAARKNLLRDLTLKQEAISLDHKSVAIGADG-------TKTVVRTPDgdrldfrEGAplqr--------------mseYS 433 Caenorhabditis ...
XP_001622655 160 DANRKRLRAAVQERSRVMDLICHAVSSVRGAGIKDQieRPSTPEVEP-------------------------------LG 208 starlet sea ane...
XP_001697824 185 EAVRAKLEADLRDKTEALRVDEAVLSIPTD-PTVEGtlSPTFRRGAAdc----pPKT---------------------PH 238 Chlamydomonas r...
XP_006637346 241 RKVQHVMEKDIDDKHAAYHIEDRCHKLMDFTSGIAF--FMDVDRMDVs------ASV---------------------PE 291 spotted gar
ESN92457     236 DWLTQVKSVHTEAEKQRQNAANLTSIADSSLKQTKDDLQNIKVATDDAFRERIYELRDHKAKMEDHLQKVVKQIQEMETT 315 Helobdella robusta
CDS43459     316 TWNKQVSDLVQRSQSERAASRMLRERIAKGIAHASKTLSDIWEAVNAAFAQRIREFTDARNQLQASLGKTLQAIFDTEKE 395 Echinococcus mu...
XP_009028491 206 AWVEQAVNLIQASQAERTKSRSLDQDINRLVGQLSGSLVKHWISTNEVLSFRIEDHLRAKHKLETHLRELSNELIDAQKT 285 Helobdella robusta
XP_005055911 298 TWARFTDNNIFRSQSARAASAKLRASTESLLMGTADEMWRQFSKVNDAFTSRITETANAKSKIQTHLAKTRQEIFQIETK 377 Collared flycat...
XP_006635248 297 SWAKFTDNNILRSQSERAASARLRDEVEILLNTTSNEMWNQFNTVNVAFTNRMAETADAKNNLQTHLAKTLQEIFQTEML 376 spotted gar
ESN99582     278 SWAKHSYDNMQRSQKEREGCMKLCNRIKEQIKWCENEMWNHSNSVNVALKVRVQTLLIVRNNLQSHLQQVNTRIQEQEKV 357 Helobdella robusta
CAP32895     434 EWIENTGNNLNYAARARVHSRKIGQKLCQSLRELASQLRTEAIAVEALLKDSVRNWQEWKDNLHSQVNGKDKEIKNADGA 513 Caenorhabditis ...
XP_001622655 209 PYTPECARVISEAADARQRSSTLRKEVAEAIEQTIKLQKAAHNSVNDGLTQKVAETVSMRQHLQVGGGELRMSIHRSKRW 288 starlet sea ane...
XP_001697824 239 TWVRNTEDNLRNAHHWLADSARLRKAIAHAVANSRATEHDVANRLNENMLAKVAATRNLREDLQAQLEKVREEQARAKGQ 318 Chlamydomonas r...
XP_006637346 292 SWAKFSENSILLSQSERAATAKVRDEVERVVEVTSREMWSQYHRVNIAFASCISETAEAKDKLQAHLAKTLQEVFQTERT 371 spotted gar
ESN92457     316 SQSLINEINIYTKKLTFEQSKIQPLQNCPQNLLDSEEV---LVTNYCTNKGNVEKLKDNLACVQCSLKSLQCRKVEVESD 392 Helobdella robusta
CDS43459     396 IEDLKKAIKDKEEYLKTATSRLNTRLLRPEVENCRDPAmihLICEVKQLKGAIEELTKQLRRAEGVLQELLHLRTAKEGE 475 Echinococcus mu...
XP_009028491 286 TEYLKKNIRDKNAPIQLAQTRLHVRANRLNMEACLDPAhekLVKELTDLDENVDELMKKLREAEYVEGHLARSIKSLQHD 365 Helobdella robusta
XP_005055911 378 IQVIQKTIKDKEAQLKVAQTRLDERTRRPNVELCRDAAqirLVQEVNEINETLRNLHQCLRASEDMLQMLVRSKGVLEQD 457 Collared flycat...
XP_006635248 377 IETLKKSIRDKESPLKVAQTRLEERTRRPNVELCRDNPhhrLVSEVREIGDTIQKLKERLRDAEDTLQTLVRTKVSLEHD 456 spotted gar
ESN99582     358 AEKIKEAIVDKEVPLQIAQTRLQERNKRIEMELCRD-----IVVELVAIREEVVMLKSKLQAVTRSIERLHKVQVKLEEE 432 Helobdella robusta
CAP32895     514 IEEISFSLKQKSGPLQVALSRQNQRGLRPGIELCNDKAqhaLHQELMMLKGTFLSLENQLDKAKESRKKLENDRDKLQRK 593 Caenorhabditis ...
XP_001622655 289 YNATEMALGYTLGPVAYSDLTTREHLDRPTVKIFQRHPgnqL-PEAREIGRGGQGLQESLNATARNIGLLKLTKDRIDSD 367 starlet sea ane...
XP_001697824 319 RSALTSALDDKRGPLAQARERLAVRKARPCRENVNDEVeaaLAKEVAHLAAVTQQLSVKVAAVDREIAALDATAAQLESN 398 Chlamydomonas r...
XP_006637346 372 ISALEEAIRNKEAPLKVAQTRLKERSKRPNIELCKDPPhskLLTEIHSINGTVASLKLHLAEARDSLQQLVNSKATLEQE 451 spotted gar
ESN92457     393 LKLCTEALTIDDYECLPMRQSIK 415 Helobdella robusta
CDS43459     476 LACKNNSLFIDRECCLALRTQWP 498 Echinococcus multilocularis
XP_009028491 366 LNLKNHSLFIDRDKCLSLRKTFN 388 Helobdella robusta
XP_005055911 458 LVVKNNSLFIDQERCMGMRKSYP 480 Collared flycatcher
XP_006635248 457 LSVKANSLFIDQEKCMGMRKSFP 479 spotted gar
ESN99582     433 IRVKDTSLDIDGRICLSLRKNIQ 455 Helobdella robusta
CAP32895     594 LDICDHNLTIDNEILRQIRSSYP 616 Caenorhabditis briggsae
XP_001622655 368 ASDKHHASLIDS-NVVRDRRRHA 389 starlet sea anemone
XP_001697824 399 IADKDDALRVDE-RVVLLDGRIN 420 Chlamydomonas reinhardtii
XP_006637346 452 LFAKAHSLFIDREKCMGIRKIFP 474 spotted gar
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap