Conserved Protein Domain Family
Sina

?
pfam03145: Sina 
Seven in absentia protein family
The seven in absentia (sina) gene was first identified in Drosophila. The Drosophila Sina protein is essential for the determination of the R7 pathway in photoreceptor cell development: the loss of functional Sina results in the transformation of the R7 precursor cell to a non- neuronal cell type. The Sina protein contains an N-terminal RING finger domain pfam00097. Through this domain, Sina binds E2 ubiquitin-conjugating enzymes (UbcD1) Sina also interacts with Tramtrack (TTK88) via PHYL. Tramtrack is a transcriptional repressor that blocks photoreceptor determination, while PHYL down-regulates the activity of TTK88. In turn, the activity of PHYL requires the activation of the Sevenless receptor tyrosine kinase, a process essential for R7 determination. It is thought that thus Sina targets TTK88 for degradation, therefore promoting the R7 pathway. Murine and human homologs of Sina have also been identified. The human homolog Siah-1 also binds E2 enzymes (UbcH5) and through a series of physical interactions, targets beta-catenin for ubiquitin degradation. Siah-1 expression is enhanced by p53, itself promoted by DNA damage. Thus this pathway links DNA damage to beta-catenin degradation. Sina proteins, therefore, physically interact with a variety of proteins. The N-terminal RING finger domain that binds ubiquitin conjugating enzymes is described in pfam00097, and does not form part of the alignment for this family. The remainder C-terminal part is involved in interactions with other proteins, and is included in this alignment. In addition to the Drosophila protein and mammalian homologs, whose similarity was noted previously, this family also includes putative homologs from Caenorhabditis elegans, Arabidopsis thaliana.
Statistics
?
PSSM-Id: 397316
Aligned: 43 rows
Threshold Bit Score: 161.618
Threshold Setting Gi: 212517414
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q7QF99       119 LRNYTLEAIVSKVQFPCRNAVKGCSVRLPLQLLRWHKERCGYKLIECFMGKvwGGCGWHGCERDWLAHCLAEHaDHVHED 198 Anopheles gambi...
XP_018678354 113 IRCLALEKLAVSLHLPCAYHHLGCEEMFPYYSKLQHETRCTYRPYTCPHPG--SDCPFTSDSLALLSHLRERH--KVDLQ 188 wild Malaysian ...
ERM93648      91 IRCLALEKLAVSLHLPCAYHRLGCEEMFPYYTKLKHEDQCVFRPYSCPHPG--SDCPVTGDVPTLVAHLREVH--KVDLQ 166 Amborella trich...
XP_010228611  95 IRCLALEKVAASLELPCKYQNFGCVGIYPYYCKMKHESQCQYRPYSCPYAG--SECTVAGDIPYLVNHLKDDH--KVDMH 170 stiff brome
XP_009405720  95 IRCLALEKVAESLELPCKYSTLGCPEIFPYYSKLKHEARCNFRPYNCPYAG--SECSVVGEIPFLVAHLRDDH--KVDMH 170 wild Malaysian ...
EEB19318      91 aKNIMLAQIAEYVKYPCPNTIGGCEEVYYLRDEETHLKKCGYIVHRCKI----DNCDWIGKKDELKSHVENLHqEDIWKK 166 human body louse
XP_008195839  54 tRNFSLESVCTVLQYPCSNEMRGCSHYMKLEEFAEHQERCDYRNYRCMFE---KYCCWQGTRDKLKKHYVDKHdNNVLIG 130 red flour beetle
XP_012551617  35 IRSAVLESLANKVLFPCTNA--GCPKHATLPLLEKHTPHCQFRIINCFMARvyGECTWEGRAGDWMDHCFSEHkQKV--- 109 domestic silkworm
Q29HR3       254 sRSLTVEALCAKAHFGCSHAAGGCQVRMPVALLPWHEQQCIYKPMKCFMGRvwGECKWQGREVQWKEHLEEQHaEKLFRS 333 Drosophila pseu...
Q178N6       160 MRNYTLEAIAAKVHFPCTHAARGCTVRLPLELLWWHKDRCGYKQIECFMGKvwEDCSWHGCEKDWIGHCVTEHqDKVYNL 239 yellow fever mo...
Q7QF99       199 R----C-VELQWaygAEAaQRApELQLVVAYHVVRAYGEAFNLYQVYDQ-DSRTVLWTVICATKESQVSGRYAFELEL-- 270 Anopheles gambi...
XP_018678354 189 A----G-CTFNHr-yVKQ-DPCsVDSCSWTLTLFNCFGQYFCLHFEAFLlGCEPVYMAFLRFMGEESEARRYNYCLEV-- 259 wild Malaysian ...
ERM93648     167 T----E-CTFNHr-yVKK-DPCaVDNVSWTLTLFHCFGHYFCLHFEAFRlGGEAVYMAFVRFMGEESEARKFSYCLEV-- 237 Amborella trich...
XP_010228611 171 S----G-STFNHr-yVKS-NPHeVENATWMLTVFSCFGEYFCLHFEAFQlGMAPVYIAFLRFMGDDTEAKNYSYSLEV-- 241 stiff brome
XP_009405720 171 T----G-CTFNHr-yVKS-NPReVENATWMLTVFYCFGQYFCLHFEAFQlGIAPVYMAFLRFMGDENEARNFSYSLEV-- 241 wild Malaysian ...
EEB19318     167 EwnfaGsRKFEH-------NDTsSDEFGKLLVIEK---ELFWMLSNYD--CEKKKLYKSFQYIGPKEAAKRFNYQICLks 234 human body louse
XP_008195839 131 S----T-SMCLWk----------EDQPDYTVHLLLAFDELFYVHKRLR----DDVMHWAVQYIGRPEDVILYYFEIQI-- 189 red flour beetle
XP_012551617 110 -------TDLPFitvKDK-WDAkRTEPILNYFLLRCFEKVFNVYQIYDK-RGGRMMWTVLV---NDDNAEKFYFEIDI-- 175 domestic silkworm
Q29HR3       334 S----T-SDLVW-------NMAaRRKPLTGYYVFQAHDEMFNFYEIYDK---QRILFTMTCTSNRRESKYNYAYEVTL-- 396 Drosophila pseu...
Q178N6       240 P----D-IVLTWnyaADS-QRCiALQSVIAYYVIRAYGEYFNVYQIYDQ-NSRRTIWTVICASKEAKTSHRFAFELEL-- 310 yellow fever mo...
Q7QF99       271 YSPvntWQLLVQRFPCH---SELDPDFLKDGHCAKLALADALRFMADd-KVLHYRVR 323 Anopheles gambiae str. PEST
XP_018678354 260 GGH---GRKLRWQGVPRs-iRTHHRMVRDSHDGLIVHRSLALYFSGGdqKELKLRVS 312 wild Malaysian banana
ERM93648     238 GGN---GRKLTWQGVPRs-iRDGHRKVRDSHDGLILQRSLALYFSGGdrKELKLRIT 290 Amborella trichopoda
XP_010228611 242 GGG---GRKMIWQGVPRs-iRDSHRKVRDSYDGLIIQRNMALFFSGGerKELKLRVT 294 stiff brome
XP_009405720 242 GGN---GRKLTWEGTPRs-iRDGHRKVRDSHDGLVIQRNMALFFSGGdrKELKLRVT 294 wild Malaysian banana
EEB19318     235 SDD---RRQFLFKSTMDd-dNRNGSDAFESPNCTVIDFSVLKSFSTyspenklkyly 287 human body louse
XP_008195839 190 FTDqfnDRKLEFSEICHddiMENIDDIIDTGFCVSVRMPILQTYINNe-GVVFYKIe 245 red flour beetle
XP_012551617 176 FLPnlpSKRIVYRRPCK---CEKDADFLEHTQNVYIPVENVFSMLDDs-EALNFIvr 228 domestic silkworm
Q29HR3       397 LQPdneALSMTQKFPVH---SEYDRDILMDGTCVSIPLNELSRFVDPe-KVLHYRVS 449 Drosophila pseudoobscura
Q178N6       311 YSPidsSKLLVQRFPCH---SENDADFLKDGNCAKIPLEEAIRFMTKd-KILYYRIR 363 yellow fever mosquito
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap