Conserved Protein Domain Family
OATP

?
pfam03137: OATP 
Organic Anion Transporter Polypeptide (OATP) family
This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs). Several have been identified mostly in human and rat. Different OATPs vary in tissue distribution and substrate specificity. Since the numbering of different OATPs in particular species was based originally on the order of discovery, similarly numbered OATPs in humans and rats did not necessarily correspond in function, tissue distribution and substrate specificity (in spite of the name, some OATPs also transport organic cations and neutral molecules). Thus, Tamai et al. initiated the current scheme of using digits for rat OATPs and letters for human ones. Prostaglandin transporter (PGT) proteins are also considered to be OATP family members. In addition, the methotrexate transporter OATK is closely related to OATPs. This family also includes several predicted proteins from Caenorhabditis elegans and Drosophila melanogaster. This similarity was not previously noted. Note: Members of this family are described (in the Swiss-Prot database) as belonging to the SLC21 family of transporters.
Statistics
?
PSSM-Id: 397311
Aligned: 226 rows
Threshold Bit Score: 365.375
Threshold Setting Gi: 746844925
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ETN67154       25 SFIMVYGFLGTVQAMAYIYFVITLTTLEKRFKIPSSTTGIILSGNEISQILLSLILSYVGGHRNRPRWIAWGVVFCALSC 104  Anopheles dar...
XP_011052736   51 LFVGLICWIGVVQAASYAYFHVTGSTIARRFQIDPYIMDWILVTAELTPIVLGLVIAYWGDKIHRASWIGALTLLQSVAH 130  Panamanian le...
EEC20306        6 AFLAVFCLTSVLQGMYYTYFVSVLTTIEKLYQIPSKTTGIIMSATEIGQIGGALLLTYYGGQGHRPKWIACGMLIFAVAS 85   black-legged ...
EFX81434        1 MFLAVFCLACVLQGMFYTYFVSVLTTIEKLFQIQSKTTGIIMSATEMGQIGGALLLTYYGGQGHRPKWIGWGMVLFGASA 80   common water ...
EFN72542       99 AFLVTFCLTWVLQGMYYTYFVSVITTIEKLFQIQSKTTGIIMSATEIGQIGSSLLLTYYGGQGHRPKWIAWGMILFAVSS 178  Florida carpe...
XP_003241873   65 VFLATFCFSWVLQGMFSTYFVSVITTLEKLFQLQSKTMGLVLSATEIGQIGSSLLLTYYGGQGHRPRWIASSMVLFGVAA 144  pea aphid
Q9VVH9        175 VFMVVFLLAYILQGMYMTYFVSVITTIEKLFQIKSKTTGILLSASEMGQICTAMLLTYFAGRGHRPRWIACGMVLFSIAA 254  fruit fly
XP_001601987  104 MFLFTFCITWVLQGMYYTYFVSVITTIEKLFQIQSKTTGMIMSATEVGQIGSSLLLTYYGGQGHRPRWIASGMVLFAVSS 183  jewel wasp
XP_024085155   54 AFLVTFCITWVLQGMFYTYFVSVITTIEKLFQLQSKTTGFIMSATEMGQIGSSLLLTYYGGQGHRPKWIACGMVLFALSA 133  bed bug
PDM64957       52 GFLTLFVIVYLMEAMGGMYIVSAIQNIEKQFRLPSKLSGILVSASDIGYIPTVIFIAYFGARGNRARWIGAGTLGMAVAY 131  Pristionchus ...
ETN67154      105 FILALPHFiYGpgedalrltkeyl---------------------------rdkaedeanlrlHqnvtmlvkssnrlcma 157  Anopheles dar...
XP_011052736  131 FVLIIPHLtHrvrvieetqnvthmslyaddspe----------------------------------------------- 163  Panamanian le...
EEC20306       86 ILCAMPHFlFIdtslsvt--------------------------------------slaraknAqnatvasqwaklchss 127  black-legged ...
EFX81434       81 ALCSLPHFlFWrtkpntgssss-------------------------------lssmlapdlyGgglgllatmdpssss- 128  common water ...
EFN72542      179 FTCSLPHFiFGeqlilqne------------------------------------mllsgvgpGgngrglnntdpipanl 222  Florida carpe...
XP_003241873  145 FACSSPHFlFGhhqyss-----------------------------------------sasmmGagnsttdyypsnmcva 183  pea aphid
Q9VVH9        255 FSCALPHFiFGeqlmhssv------------------------------------ilqqtqvsPpnnsfsshwlnasseq 298  fruit fly
XP_001601987  184 FTCSMPHFiYGqqlirqne------------------------------------llfnggtvSgqlngtnvtspvpanl 227  jewel wasp
XP_024085155  134 FACSLPHFmFGqqmlte-----------------------------------------nssvlVppntcrldsylalnss 172  bed bug
PDM64957      132 LLIASPNFlFPtpplargtfgyvkdslmpsnellapnaslalllhyplisdrftpaqignlskFpvaaeinhqmvinnks 211  Pristionchus ...
ETN67154      158 e---------------------------------------------------------------------stekecldti 168  Anopheles dar...
XP_011052736  164 -----------------------------------------------------------------lctpvlsriileeep 178  Panamanian le...
EEC20306      128 -----------------------------------------------------------------------dmplsqsri 136  black-legged ...
EFX81434      129 ------------------------------------------------------------------------eqqaisrt 136  common water ...
EFN72542      223 ckfpernntldgwnist--------------------------------------pasqtdsseyckgdflreqriqski 264  Florida carpe...
XP_003241873  184 pdlnisdsgstrq---------------------------------------------pvqqhdmceqnelseqleqsrn 218  pea aphid
Q9VVH9        299 vnpnlcilggnq-----------------------------------------------thsgsecneerqleqashski 331  fruit fly
XP_001601987  228 ckfldkvensssngwsmat---------------------------------aseilrtdtaeycegddfrteqrihski 274  jewel wasp
XP_024085155  173 iyddqc------------------------------------------------------------keeylveqriqski 192  bed bug
PDM64957      212 spymvdyglmheavfeahkllnstpdaadaskfrsllatyvarrkdgmraasnapfsycsalvnsmqakirelkcmnged 291  Pristionchus ...
ETN67154      169 sivplvlIFMSQFVLGIGNTLYYSLGQTYLDDNTKKTNTPLMLAYASSLRTFGPVVGFALGYLALKIYIDP----TKTPi 244  Anopheles dar...
XP_011052736  179 cyitmviIILVLIVSGMSNITYYALGISYLDDNTKRKHVTGFIGIIIAVKITGIVLGYLLGWGCLRID---------AEd 249  Panamanian le...
EEC20306      137 thvvlsvFFISLLLIGIGATAVYTLGIPYIDDNVANRESPLYFGITIGVRIFGPVFGFLLGSYCTSVYVNF----PFETs 212  black-legged ...
EFX81434      137 ttvvlafFFLSLLGIGMGRTAVETLGIPYMDDNVAGRESPTYFAINIGVKILGPVFGFVLGSLCTSIYVDP----LVEPd 212  common water ...
EFN72542      265 ttvvlaiFFVSLLGVGMGQTAVYTLGIPYIDDNVASRESPLYFAITIGVRILGPALGFILGSLCTMVYADL----TRTPq 340  Florida carpe...
XP_003241873  219 tqivlviFFTSLLGVGIGQTAVYTLGIPFIDDNVASRESPLYFSITIGVRILGPSFGFLLGALCTSLYADL----SSEPn 294  pea aphid
Q9VVH9        332 tvivlciFFGSLLSSGIGQTAVATLGIPYIDDNVGSKQSPMYMAVTIGMRILGPASGFIFGSFCTRWYVNF----S-NPg 406  fruit fly
XP_001601987  275 ntvvfaiFFVSLLGVGMGQTAVNTLGIPYIDDNVTSRESPLYFSITIGVKILGPAMGFMLGSLCTRIYADL----SVDPp 350  jewel wasp
XP_024085155  193 ttlvlaiFFISLLGVGMGQTAVYTLGIPYIDDNVASRESPLYFAITIGVRILGPALGFILGSLCTRLYVDL----SLDPq 268  bed bug
PDM64957      292 shgpfivFCMALLLLGIGRTLPWSLGVPLIDDNVSKKSMPTYFGAISFIRILGPISGFLVASVVNKFYFDFnppeGLRP- 370  Pristionchus ...
ETN67154      245 i-dsSDPR-WLGAWWLGWILLGIAMLFFAMLTGLFPKEIPKKQAAAATTTKRpnsnmpvilmndaeafgkEKEELRQAAR 322  Anopheles dar...
XP_011052736  250 fsvvNSYRdQIGAWWLGFPILSILLVIPGLLLSWFPRRLPSEVVEQAAASLLdra-------------aiRNRAPHRTTS 316  Panamanian le...
EEC20306      213 nlspGDPH-WIGAWWLGVFIVGAALIVTALPMMAFPRNLPQRRSLAQLRALRp----------------gSDQHRNGMVC 275  black-legged ...
EFX81434      213 v-tpKDPR-WIGAWWLGMIFVASTILLASLSMFAFPRRLPRKGRQAAHRPKQingkm---------lpaqAKTEQTVASA 281  common water ...
EFN72542      341 i-tpTDPR-WVGAWWLGLVLISAMLMFVSIGMFAFPTRLP-KSRT--------------------------------PPR 385  Florida carpe...
XP_003241873  295 m-dtNNPR-WVGAWWLGLVGISATLLLASVPMFAFPKRLPGPSSASNATLKKqnppqla-----vngcaePSLSSPPPPP 367  pea aphid
Q9VVH9        407 f-daTDPR-WIGAWWLGPVAIGSLMLLASIAMFSFPKQLRGKQKPPGQT-------------------------ATPAAP 459  fruit fly
XP_001601987  351 i-tpSDPR-WVGAWWLGLVFISTMLLIVSIGMFAFPMRLP-TSRT--------------------------------PPK 395  jewel wasp
XP_024085155  269 i-tpTDPR-WVGAWWLGLVMISSLLILSSLAMFSFPKRLS-TCRPIA-----------------------------PSKK 316  bed bug
PDM64957      371 ----EDQS-WIGAWWLGFIIIGVLTIVPSIALCLFPTANVNVTSADGKQRKIn-----------------FNDKHRDMEN 428  Pristionchus ...
ETN67154      323 HQrtvsenapefaesivEFPKLKDFPTALMRLLKNKLLMFNILSGIFYILGSSGYITFLSKYIEVQFHKSPANATVITG- 401  Anopheles dar...
XP_011052736  317 QK-----------------VGNPDFWPSLCRLFTNRILICNILATAFSAMALLNFMTLENIFLESRFLIPRPTGMLR-Gf 378  Panamanian le...
EEC20306      276 LKhqqalq----qklyiAPSSLSDFPSAIRRLLKNEILLYRTASSVLHILPIAGLYTFLPKYLESQFRLTETKANMITG- 350  black-legged ...
EFX81434      282 MRn--------------KNPSLKDFPKAIRRLLKNDILLFRTASSVLHILPVAGLYTFLPKYLESQFRMAAHTANMISG- 346  common water ...
EFN72542      386 RAd-------------aKKPSLRDFPSAVKRLLKNDILMFRTASSVLHILPIAGLYTFLPKYLESQFRLPAHHANMISG- 451  Florida carpe...
XP_003241873  368 YDgls---------avpKAPRLKDFPTAVKRLLKNDMLMYRTASSVFHLLPLAGIYTFLPKYFESQFHFPTHTANMVTG- 437  pea aphid
Q9VVH9        460 VEp-------------eEKPKLKDFPKTVRRQLSNDILMFRTASCVFHLLPIAGLYTFLPKYLETQFRLATYDANMIAA- 525  fruit fly
XP_001601987  396 VAd-------------aKKPSLKDFPKAVKRLLKNDILIFRTASSVLHILPIAGLYTFLPKYLESQFRLAAHDANFIAG- 461  jewel wasp
XP_024085155  317 HPrdk----------prKNPSLRDFPKAVKRLLKNDILMFRTASSVLHILPIAGLYTFLPKYLESQFRLTAHDANMFSG- 385  bed bug
PDM64957      429 SEk-------------gLSERIKDFGSTYRSVITSKIYVYSATGRILDIMAFKGYIVFLPKYLENHFGIARYLVHRYMA- 494  Pristionchus ...
ETN67154      402 --------PI-TLfGMVAGF--LISGIVISKKKPSPRKLLFWNVIVGFGYMAGQFSYLFlTCPDGTMPL---VQGRLN-- 465  Anopheles dar...
XP_011052736  379 ddplpsrlVTnIGrPILIGLviIISGLVLAKAKPRARFIIGYSFIIVFLIIAIIIGLIFaTCDKSSVVNlekss------ 452  Panamanian le...
EEC20306      351 --------FA-GIlVMGVGI--FASGTFMRKYKPNARFVAKWIAFCALAYSIGMVILMWvGCPLGEYVGl--NS---Ehk 414  black-legged ...
EFX81434      347 --------IG-GIgVMGIGI--FFSGVFIRLKKPSPKFVAAWIALTALLYAIGMALLMLlGCPMSDFSGl--EQ---Tds 410  common water ...
EFN72542      452 --------VG-GIlVMGLGI--IISGVFILRAKPNARFVAAWIAFTAVVYAIGMGVLMFiGCPMDDFAGl--VS---Hsd 515  Florida carpe...
XP_003241873  438 --------IY-GImVMGIGI--IISGIFILKKNPNARAVAAWIAFTALAYAIGMCILMFfGCPTTNITGl--RY---Del 501  pea aphid
Q9VVH9        526 --------FC-GIlVMGIGI--VISGLFILKRKPTARGVAAWIAFTALVYSAGMIILMFiGCSMNDFAGy--KP---Sdg 589  fruit fly
XP_001601987  462 --------VG-GIlVMGVGI--ILSGFFILKANLNARFVAGWIAFTAIAYAIGMGILMFvGCPMNDFTGl--VT---Neq 525  jewel wasp
XP_024085155  386 --------VG-GIlVMGLGI--ILSGVFILRVKPNARFVAAWIAFTAVIYAIGMGILMFmGCPMTDFVGl---K---Ret 448  bed bug
PDM64957      495 --------IF-GVfGFALGS--GCGGLLTRKFKLNGKRVALYVFIVSSLNILMYFSKIFiACDSSLAEIgrqHEGATYn- 562  Pristionchus ...
ETN67154      466 -----LTTECNSH--CHCDGIPYTPVCQEetgitffsachagcdnwhtadkyydrcscqnenyspitklpwerppngsgs 538  Anopheles dar...
XP_011052736  453 ---dtllRYCNKD--CRCSKDADFRPICDss------------------------------------------------- 478  Panamanian le...
EEC20306      415 g-ldfLPPACNSS--CDCKSGLFSPV------------------------------------------------------ 437  black-legged ...
EFX81434      411 g--mtVKLPCNRT--CECDTSVFAPICTStg------------------------------------------------- 437  common water ...
EFN72542      516 g-lssFEPICEAS--CDCDRNKFSPICGAdgrtyfsach----------------------------------------- 551  Florida carpe...
XP_003241873  502 n-qpkFESSCSDQ--CVCDEELFSPICGVdgi------------------------------------------------ 530  pea aphid
Q9VVH9        590 nspalIEPTCSAAlnCTCDKENFAPICADg-------------------------------------------------- 619  fruit fly
XP_001601987  526 g-lshFEPICEAT--CDCDKNKFSPICGAdgr------------------------------------------------ 554  jewel wasp
XP_024085155  449 s-lsrFEPVCDSG--CKCDYNKFNPICGKdgk------------------------------------------------ 477  bed bug
PDM64957      563 -----LTHSCNVD--CGCEGAKLYPVCDRs-------------------------------------------------- 585  Pristionchus ...
ETN67154      539 atylpsthpyqttvststvlvqyTTTDAPSSTRSETTESTTTLSTSTAAVTVTDTiqlladanetkvnytlshdsppdlm 618  Anopheles dar...
XP_011052736  479 ---------------------geFTYYNPCYAGCSTIIYVDDVKIYSGCNCVEEMt------------------------ 513  Panamanian le...
EEC20306      438 --------------------------CHNSVTYLS-PCLAGCSQPTFNSCHCTGTn------------------------ 466  black-legged ...
EFX81434      438 ---------------------etYFSACHAGCANLTQFGSQIGNTTYSNCECLDAg------------------------ 472  common water ...
EFN72542      552 --------------agcsnytvaDGKVASVSAKPSRNNTPQDMFYNCQCIEHNVTipe---------------------- 595  Florida carpe...
XP_003241873  531 --------------------tyfSACHAGCRNRTSRKEYISGYKFTDCQCMNTNAte----------------------- 567  pea aphid
Q9VVH9        620 ----------------------kMYISACHAGCSSSSLRPSDNRTLYSDCACIPDa------------------------ 653  fruit fly
XP_001601987  555 ---------------------tyFSACHAGCSNYTV-FEGKVANFTDCQCIPRNFsm----------------------- 589  jewel wasp
XP_024085155  478 ---------------------tyFSACHAGCQNVTIIDGKEVEFSDCLCMDNYDPgg----------------------- 513  bed bug
PDM64957      586 ----------------------gKPFFSPCHAGCREASHHGEHTSIEFSSCACAA------------------------- 618  Pristionchus ...
ETN67154      619 apdatgelpmeitesttavpvdgedsvvmeaaeeaassypeaerrrkratstgdgedsstttnppdttLySVKLVPGACI 698  Anopheles dar...
XP_011052736  514 -------------------------------------------------------------------eWgNDQAKDGPCD 526  Panamanian le...
EEC20306      467 --------------------------------------------------------------------Dt---ISNGFCS 475  black-legged ...
EFX81434      473 --------------------------------------------------------------------Vt---ATSGYCH 481  common water ...
EFN72542      596 ------------------------------------------------------------------afSt---ATIGYCE 606  Florida carpe...
XP_003241873  568 ------------------------------------------------------------------afP-------GPCK 574  pea aphid
Q9VVH9        654 --------------------------------------------------------------------Pe---AVNGYCD 662  fruit fly
XP_001601987  590 ------------------------------------------------------------------peMp---AQTGYCP 600  jewel wasp
XP_024085155  514 ------------------------------------------------------------------qpNk---ASVGYCN 524  bed bug
PDM64957      619 --------------------------------------------------------------------D--GRVAKEWCV 628  Pristionchus ...
ETN67154      699 -QGCALgFYLFSIISSIINCLGASGRIGNLLVNYRCVSKQDKSFTQGLILMMISLFALIPGPIIYGRIIDSTCLVWTEEC 777  Anopheles dar...
XP_011052736  527 sSKCQVgWMVFEFGSLLAYTLIASTFVGDILVNIRSVYKQDKAISIGFWMMWVAVFVYIPGKIVYEFVSNQMCQYW---- 602  Panamanian le...
EEC20306      476 -LECNNl-VWYIIVFSFFVLIHSTSEVGSMLLTLRCVESHDKALALGLIQFAIGLFGNVPCPIIYGAVVDSACLFWEDNC 553  black-legged ...
EFX81434      482 -LECNNy-IWYIGIFSLFVLIHSTSEVGSMLLTLRCVHAKDKAMALGLIQFAIGLFANVPCPIIYGAVVDSACFVWEKTC 559  common water ...
EFN72542      607 -LECSNf-WVYMILFSVFVFIHSTSEVGSMLLILRCVDPRDKAMALGLIQFAIGLFGNVPCPIVYGAVVDSACLVWEYAC 684  Florida carpe...
XP_003241873  575 -DDCEDsGFWYIALFSLFVFIHSTSEVGSMLLILRCVHPQDKAMALGLIQFAIGLFGNVPCPILYGAVVDSACLIWEMTC 653  pea aphid
Q9VVH9        663 -NNCKNf-IYFILIFAICVFMHSTSEVGSMLLVMRCTHPKDKAMAMGVIQSAIGLFGNVPCPIIYGAVVDSACLIWKSVC 740  fruit fly
XP_001601987  601 -LDCNNf-YAYVILFSVFVFIHSTSEVGSMLLILRCVDPRDKAMALGLIQFSIGLFGNVPCPIVYGAVVDSACLVWEYAC 678  jewel wasp
XP_024085155  525 -LECGNf-IWYILLFSLFAFVHSTSEVGSMLLILRCVDPTDKAMALGLIQFAIGLFGNVPCPIVYGAVVDSACLIWETTC 602  bed bug
PDM64957      629 -QSCKPaTVAFFSTVLIGSFIGGLGIVPGLLILIRSVPPATRSAALGLQGFMISLFGTLPSPIIWGAIVDSTCLIWDHAC 707  Pristionchus ...
ETN67154      778 -GKR-GNCQLHDQKLF 791  Anopheles darlingi
XP_011052736  603 -GSQkTICHLHNSEKL 617  Panamanian leafcutter ant
EEC20306      554 -GEP-GACRVYDPSKF 567  black-legged tick
EFX81434      560 -GEQ-GACWLYDAKTF 573  common water flea
EFN72542      685 -GER-GACWLYDSNVF 698  Florida carpenter ant
XP_003241873  654 -GKQ-GACSLYNSDSF 667  pea aphid
Q9VVH9        741 -GKH-GACSLYDADTF 754  fruit fly
XP_001601987  679 -GER-GACWLYDSNVF 692  jewel wasp
XP_024085155  603 -GKQ-GACKLYDENFF 616  bed bug
PDM64957      708 dGAR-GSCSLYDPAAL 722  Pristionchus pacificus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap