1AUU,3RIO


Conserved Protein Domain Family
CAT_RBD

?
pfam03123: CAT_RBD 
Click on image for an interactive view with Cn3D
CAT RNA binding domain
This RNA binding domain is found at the amino terminus of transcriptional antitermination proteins such as BglG, SacY and LicT. These proteins control the expression of sugar metabolising operons in Gram+ and Gram- bacteria. This domain has been called the CAT (Co-AntiTerminator) domain. It binds as a dimer to short Ribonucleotidic Anti-Terminator (RAT) hairpin, each monomer interacting symmetrically with both strands of the RAT hairpin. In the full-length protein, CAT is followed by two phosphorylatable PTS regulation domains (pfam00874) that modulate the RNA binding activity of CAT. Upon activation, the dimeric proteins bind to RAT targets in the nascent mRNA, thereby preventing abortive dissociation of the RNA polymerase from the DNA template.
Statistics
?
PSSM-Id: 397302
Aligned: 187 rows
Threshold Bit Score: 47.7995
Threshold Setting Gi: 212561248
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1AUU_B         3 IKRILNHNAIVVKDQ--NEEKILLGAGIAFNKKKNDIVDPSKIEKTFIRKDTPDY 55  Bacillus subtilis
CBL25480       4 VIKVLNNNGILVYHVetGKEMILLGNGVGFGKKPTEQIEKLPGAKVYSLVTRRKQ 58  [Ruminococcus] torques L2-14
WP_022415813   5 IEKVLNHNTVMAIHQddHKEVLIMGKGVGFGRKVAERIEVRPEDRLYSLQKYKEr 59  Dorea longicatena
CCX88610       4 VEKVLNHNAVIAIHDenHGEYLLMGKGIGFGKKINERMETRDTDTVYSLQESTEr 58  Clostridium sp. CAG:590
WP_118660972   4 ISKVLNHNGVIVIDLndQKEYVLLGKGAGFGRKIGERMEKPETCTVYSLQETSsk 58  Dorea sp. OM07-5
CDE69830       4 IGKVLNHNAVLAVNAedGKQYLLMGKGIGFGKKVSERVEPGEDSRIYTLQACEer 58  Clostridium sp. CAG:277
CDA86448       4 VVKALNHNAVLAADVtdQKEYLLMGKGIGFGKKVSEQFEADESYRVYSLTDRKER 58  Clostridium sp. CAG:230
CDF41707       4 VTKALNHNAVLAIMDksSREYLLLGKGIGFGRKVSEYIEPTEDCRIYSLSSDSEr 58  Roseburia sp. CAG:182
EHJ01614       4 VIKALNHNGVLAINMdnYKEYILLGKGIGFGKKVNERIEAPENAHIYLLQQETEr 58  Clostridium sp. DL-VIII
CBL23010       5 IAKILNHNSFIGISDenDQECLVMGKGVAFGKKVGQTVSAATEAKAYSLKEMTEr 59  Blautia obeum A2-162
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap