6PPB,6ODM


Conserved Protein Domain Family
Herpes_MCP

?
pfam03122: Herpes_MCP 
Herpes virus major capsid protein
This family represents the major capsid protein (MCP) of herpes viruses. The capsid shell consists of 150 MCP hexamers and 12 MCP pentamers. One pentamer is found at each of the 12 apices of the icosahedral shell, and the hexamers form the edges and 20 faces.
Statistics
?
PSSM-Id: 397301
Aligned: 13 rows
Threshold Bit Score: 1863.6
Threshold Setting Gi: 81987364
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6PPB_S   13 LATEANLLTQIKESAADGLFKSFQLLLGKDAReGSVRFEALLGVYTNVVEFVKFLETALAAACVNTEFKDLRRMIDGKIQ 92  
P03226   15 LTVDADLLSNLRQSAAEGLFHSFDLLVGKDAReAGIKFEVLLGVYTNAIQYVRFLETALAVSCVNTEFKDLSRMTDGKIQ 94   Epstein-Barr virus ...
Q66628   14 FATEANLLKGIKESAAEGLFKSFQLLLGKDVReNGVKFEVLLGVYSNVIQYIKFLETSLAVGCINTEFKDLRRMTNGKIQ 93   Equid herpesvirus t...
Q2HRA7   13 LATEANLLTQIKESAADGLFKSFQLLLGKDAReGSVRFEALLGVYTNVVEFVKFLETALAAACVNTEFKDLRRMIDGKIQ 92   Human herpesvirus 8...
Q00999   11 MVSDANLLQQIKESSAEGLFKSFSLLLGKDVReSGVKFEALLGVYTNATQFVKFLETSLAVSCVNTEFKDLKRMTDGKIQ 90   Herpesvirus saimiri...
O36375   14 AAVEANLLRQVKESAAEGLFKSFQLLVGKDVReNSVRFEVLLGVYANVIEFVKFLETGLAASCINTEFRDLKRMVDGKIQ 93   Alcelaphine herpesv...
F5HGT1   13 VGIPTDFLTHVKTSAGEEMFEALRIYYGDDPErYNIHFEAIFGTFCNRLEWVYFLTSGLAAAAHAIKFHDLNKLTTGKML 92   Human herpesvirus 5...
P17887   13 IEAPLNIFNDIKTYTAEQLFDNLRIYFGDDPSrYNISFEALLGIYCNKIEWINFFTTPIAVAANVIRFNDVSRMTLGKVL 92   Human herpesvirus 6...
P06491   17 MVPTGSLLSTIEVASHRRLFDFFSRVRSDANSlYDVEFDALLGSYCNTLSLVRFLELGLSVACVCTKFPELAYMNEGRVQ 96   Human alphaherpesvi...
P09245   29 IIPTGNVLSTIEVCAHRCIFDFFKQIRSDDNSlYSAQFDILLGTYCNTLNFVRFLELGLSVACICTKFPELAYVRDGVIQ 108  Human herpesvirus 3...
Q9E6P8   30 LAPTGRLLSTIEMSSHRCMFDYFKQFSSDDNGrYAAQFDLLLGTYCNTLSLIRFLETGLSVACVCTRAPDLMYMREGTVQ 109  Marek's disease her...
Q6UDI4   34 FVVAGESLGALRDKCHAYFYDSFSSFTGVDCC-YGSRFDILLGSYFNTITLSHFLETGLSIACICVKFPELKYAEDGIVQ 112  Psittacid herpesvir...
6ODM_S   17 MVPTGSLLSTIEVASHRRLFDFFSRVRSDANSlYDVEFDALLGSYCNTLSLVRFLELGLSVACVCTKFPELAYMNEGRVQ 96  
6PPB_S   93 FKISMPTIAHGDGRRPNKQRQYIVMKACNKHHIGAEIELAAADIELLFAE--KETPLDFTEYAGAIKTITSALQFGMDAL 170 
P03226   95 FRISVPTIAHGDGRRPSKQRTFIVVKNCHKHHISTEMELSMLDLEILHSI--PETPVEYAEYVGAVKTVASALQFGVDAL 172  Epstein-Barr virus ...
Q66628   94 FKINVPTIAHGDGRRPTKQRQYIVLKTANKHHISTEMELAVLDLEILHSS--QETALDVTEYIGAVKTITSALQFGVDAL 171  Equid herpesvirus t...
Q2HRA7   93 FKISMPTIAHGDGRRPNKQRQYIVMKACNKHHIGAEIELAAADIELLFAE--KETPLDFTEYAGAIKTITSALQFGMDAL 170  Human herpesvirus 8...
Q00999   91 FKINVPTIAHGDGRRPQKQKQFIIMKATNKHHIGAEIELSTQDLELLFLS--KETPLDVTEYVGAVKTITSALQFGIDAL 168  Herpesvirus saimiri...
O36375   94 FKVSVPTIAHSDGRRPNKQRQYIVMKCTSKHHISAEIELAIADLENMHME--PETDLDMLEYIGTVKTVTSALQFGIDAL 171  Alcelaphine herpesv...
F5HGT1   93 FHVQVPRVASGAGLPTSRQTTIMVTKYSEKSPITIPFELSAACLTYLRETf-EGTILDKILNVEAMHTVLRALKNTADAM 171  Human herpesvirus 5...
P17887   93 FFIQLPRVATGNDVTASKETTIMVAKHSEKHPINISFDLSAACLEHLENTf-KNTVIDQILNINALHTVLRSLKNSADSL 171  Human herpesvirus 6...
P06491   97 FEVHQPLIARDGPHPIEQPTHNYMTKIIDRRALNAAFSLATEAIALLTGEalDGTGIGAHRQLRAIQQLARNVQAVLGAF 176  Human alphaherpesvi...
P09245  109 FEVQQPMIARDGPHPVDQPVHNYMVKRIHKRSLSAAFAIASEALSLLSNTyvDGTEIDSSLRIRAIQQMARNLRTVLDSF 188  Human herpesvirus 3...
Q9E6P8  110 FEIQQPMIAREGPHPADQPIHTYMVKRLCRRSLSAAFVVAAEALALLSEVslDGTAISTHLRMRAIQQLARNVRTILDSF 189  Marek's disease her...
Q6UDI4  113 FVVANPMIARSDCEVPSRPSYTYVTKKWSRTTLTSSLSICGPALELLTGDalDGTEIANFSRARAMNQLARDLKLTLDSF 192  Psittacid herpesvir...
6ODM_S   97 FEVHQPLIARDGPHPIEQPTHNYMTKIIDRRALNAAFSLATEAIALLTGEalDGTGISAHRQLRAIQQLARNVQAVLGAF 176 
6PPB_S  171 ERGLVDTVLAVKLRHAPPVFILKTLGD-PVYSERGLKKAVKSDMVSMFKAHLIEHSFFLDKAElmtRG----KQYVLTML 245 
P03226  173 ERGLINTVLSVKLRHAPPMFILQTLAD-PTFTERGFSKTVKSDLIAMFKRHLLEHSFFLDRAE---NMgsgfSQYVRSRL 248  Epstein-Barr virus ...
Q66628  172 ERGLVDTVLHVKLRSAPPMFIYKTLND-PTIVERGMKKTVKSDLVAMFKAHLVEHTFFLDKAQ---YAsq-sVQYVMTML 246  Equid herpesvirus t...
Q2HRA7  171 ERGLVDTVLAVKLRHAPPVFILKTLGD-PVYSERGLKKAVKSDMVSMFKAHLIEHSFFLDKAE---LMtr-gKQYVLTML 245  Human herpesvirus 8...
Q00999  169 ERGLIDTVLTVKLRHAPPLFILKTLAD-PTYTERGLKKNVKSDLISMFKTHLVNNSFFLDKSE---HLph-sRQYVLGIL 243  Herpesvirus saimiri...
O36375  172 ERGLIDTVLSVKLRHAPPLFILQSLSD-PTLTERGLKKSIKSDLVSMFKDHLITHSFFINKAE---ALat-pRQYILGML 246  Alcelaphine herpesv...
F5HGT1  172 ERGLIHSFLQTLLRKAPPYFVVQTLVEnATLARQALNRIQRSNILQSFKAKMLATLFLLNRTR---D-----RDYVLKFL 243  Human herpesvirus 5...
P17887  172 ERGLIHAFMQTLLRKSPPQFIVLTMNEnKVHNKQALSRVQRSNMFQSLKNRLLTSLFFLNRNN---N-----ISYIYRIL 243  Human herpesvirus 6...
P06491  177 ERGTADQMLHVLLEKAPPLALLLPMQR-YLDNGRLATRVARATLVAELKRSFCETSFFLGKAG---HR----REAVEAWL 248  Human alphaherpesvi...
P09245  189 ERGTADQLLGVLLEKAPPLSLLSPINK-FQPEGH-LNRVARAALLSDLKRRVCADMFFMTRHA---RE----PRLISAYL 259  Human herpesvirus 3...
Q9E6P8  190 ERGTVDQMLRILLEKAPPAPLLIPLSR-SQAEGRIAGQVMRANLVSELKRTVRTESFIMNKTN---AN----RDTIISFL 261  Marek's disease her...
Q6UDI4  193 ERGTVHHVLGILIRKAPPMPLLQPLMA-AMARERDMNVVARANILSAMKNAVREHLFFMDKES---RGd---PQDIARGL 265  Psittacid herpesvir...
6ODM_S  177 ERGTADQMLHVLLEKAPPLALLLPMQR-YLDNGRLATRVARATLVAELKRSFCETSFFLGKAG---HR----REAVEAWL 248 
6PPB_S  246 SDMLAAVcEDTVFKGVSTYTTAS-GQQVAGVLETTDSVMrRLMNLLGQ-VESA-MSGPAAYASYVVRGANLVTAVSYGRA 322 
P03226  249 SEMVAAVsGESVLKGVSTYTTAKgGEPVGGVFIVTDNVLrQLLTFLGEeADNQ-IMGPSSYASFVVRGENLVTAVSYGRV 327  Epstein-Barr virus ...
Q66628  247 SDMAATVcNETVFKGIASYTTPS-GEVVDGVLETTDNVMrKLLAMLGq-SGNS-IVGPASYASYVVRGDNLVTAVSYGRA 323  Equid herpesvirus t...
Q2HRA7  246 SDMLAAVcEDTVFKGVSTYTTAS-GQQVAGVLETTDSVMrRLMNLLGq-VESA-MSGPAAYASYVVRGANLVTAVSYGRA 322  Human herpesvirus 8...
Q00999  244 TEMIGAVcKETVFKGISTYSTAN-GQPISGVLETTDKVMrKLVNVIGq-ADNS-IMGPAAYANYVVRGENLVTAISYGKA 320  Herpesvirus saimiri...
O36375  247 SSIINSVsKETVFKGTSTYTTSS-GEPVAGVIETTDAILnKLLTLLGe-YKTE-VVGPAAYASYVVRGENLVTAVSYGRA 323  Alcelaphine herpesv...
F5HGT1  244 TRLAEAA-TDSILDNPTTYTTSS-GAKISGVMVSTANVMqIIMSLLSShITKEtVSAPATYGNFVLSPENAVTAISYHSI 321  Human herpesvirus 5...
P17887  244 NDMMESV-TESILNDTNNYTSKE-NVPLDGVLLGPIGSIqKLTSILSQyISTQvVSAPISYGHFIMGKENAVTAIAYRAI 321  Human herpesvirus 6...
P06491  249 VDLTTAT-QPSVAVPRLTHADTR-GRPVDGVLVTTAPIKqRLLQSFLKvEDTE-ADVPVTYGEMVLNGANLVTALVMGKA 325  Human alphaherpesvi...
P09245  260 SDMVSCT-QPSVMVSRITHTNTR-GRQVDGVLVTTATLKrQLLQGILQiDDTA-ADVPVTYGEMVLQGTNLVTALVMGKA 336  Human herpesvirus 3...
Q9E6P8  262 TKMVNCT-HQTISMPRLTHSDSK-GRLVDGVLVTTTMVRqKLLSGILDvVDTS-ARVPVTYGEMIISGTNLVTAVVMGKA 338  Marek's disease her...
Q6UDI4  266 LSLINCT-LPSVSDTRVTHVGPG-GRPIDGVLVTTEAVK-GLVTQALTlTASE-ATVPAMYGELSISGTNLVTALLMGKA 341  Psittacid herpesvir...
6ODM_S  249 VDLTTAT-QPSVAVPRLTHADTR-GRPVDGVLVTTAPIKqRLLQSFLKvEDTE-ADVPVTYGEMVLNGANLVTALVMGKA 325 
6PPB_S  323 MRNFEQFMARIVDHPNalP---SV-EGDKAAl--ADGHDEIQRTRIAASLVKIGDKFVAIESLQ-RMYNETQFPCPLNRR 395 
P03226  328 MRTFEHFMARIVDSPE--Ka-gST-KSDLPAv--AAGVEDQPRVPISAAVIKLGNHAVAVESLQ-KMYNDTQSPYPLNRR 400  Epstein-Barr virus ...
Q66628  324 MVAFDQFVSRLVDNPN--AtpsSV-EDDLNAissAAGLGQQNRMAIPSSVIRVGDKTIAVESLQ-NMYTEAQVPFPLNRR 399  Equid herpesvirus t...
Q2HRA7  323 MRNFEQFMARIVDHPN--Al-pSV-EGDKAAl--ADGHDEIQRTRIAASLVKIGDKFVAIESLQ-RMYNETQFPCPLNRR 395  Human herpesvirus 8...
Q00999  321 MRNFDHFMSKLVDNPT--S------NLDNDAvdtFESTGSIQKTPISTSVVMVGNKLIALESLQ-RMYNETQLPYPLNRR 391  Herpesvirus saimiri...
O36375  324 MRSFEQFKNKLVDDPV--GqagSL-DKNad---sDNEYSSLPQTTIPVSVVKVGSQPVIVESIQ-KMYNEAQAPFPLNRR 396  Alcelaphine herpesv...
F5HGT1  322 LADFNSYKAHLTS------------GQPHLPndsLSQAGAHSLTPLSMDVIRLGEKTVIMENLR-RVYKNTDTKDPLERN 388  Human herpesvirus 5...
P17887  322 MADFTQFTVNAGT------------EQQDTNnksEIFDKSRAYADLKLNTLKLGDKLVAFDHLH-KVYKNTDVNDPLEQS 388  Human herpesvirus 6...
P06491  326 VRSLDDVGRHLLEMQE--E------QLDLNRqtlDELESAPQTTRVRADLVSIGEKLVFLEALEkRIYAATNVPYPLVGA 397  Human alphaherpesvi...
P09245  337 VRGMDDVARHLLDITD--PntlNIpSIPPQSnsdSTTAGLPVNARVPADLVIVGDKLVFLEALErRVYQATRVAYPLIGN 414  Human herpesvirus 3...
Q9E6P8  339 VRNMDDIARYILNLKE--Dn-----IIDRTDeivRGDDDRPQTAEISAELVTIGDKLIFLESMErRVYQATQVQYPLIGH 411  Marek's disease her...
Q6UDI4  342 IRNFNEAARNLLNFAD--G---NV-DVSDFPdipQDGEDAPRTMSVNMSLVTVGDSLVAVEALE-RIYARTGVPYPLAGN 414  Psittacid herpesvir...
6ODM_S  326 VRSLDDVGRHLLEMQE--E------QLDLNRqtlDELESAPQTTRVRADLVSIGEKLIFLEALEkRIYAATNVPYPLVGA 397 
6PPB_S  396 IQYTYFFPVGLHLPv--PRYST-SVSVR-----GVESPAIQ-STETWVVNKNNVPLCFGYQNALKSICHPRMHNPTQSAQ 466 
P03226  401 MQYSYYFPVGLFMPn--PKYTT-SAAIK-----MLDNPTQQlPVEAWIVNKNNLLLAFNLQNALKVLCHPRLHTPAHTLN 472  Epstein-Barr virus ...
Q66628  400 LQYSYYFPVGLHMPk--PKYST-SNVIR-----GAENPLYQ-PVEAWVVNKNNTLLRFDYTCALRSLCHPKVHNPNPCAG 470  Equid herpesvirus t...
Q2HRA7  396 IQYTYFFPVGLHLPv--PRYST-SVSVR-----GVESPAIQ-STETWVVNKNNVPLCFGYQNALKSICHPRMHNPTQSAQ 466  Human herpesvirus 8...
Q00999  392 MHYTYYFPVGLHLPs--PKYST-SMSVK-----GTENVLHQ-SVEAWIVNKNNTLQCFNYQNALKSICHPRMNSPILCAR 462  Herpesvirus saimiri...
O36375  397 MQYTYFFPLGLFIPr--PKYTT-STSVK-----LEDDSCL--SSEVWVVNKTNTPLCFNYQNALRTLCHPRVNSPSACLQ 466  Alcelaphine herpesv...
F5HGT1  389 VDLTFFFPVGLYLPe-dRGYTTvESKVK-----LNDTVRNAlPTTAYLLNRDRAVQKIDFVDALKTLCHPVLHEPAPCLQ 462  Human herpesvirus 5...
P17887  389 LQLTFFFPLGIYIPs-eTGFSTmETRVK-----LNDTMENNlPTSVFFHNKDQVVQRIDFADILPSVCHPIVHDSTIVER 462  Human herpesvirus 6...
P06491  398 MDLTFVLPLGLFNPv-mERFAAhAGDLVpa--pGHPDPRAFpPRQLFFWGKDRQVLRLSLEHAIGTVCHPSLMNVDAAVG 474  Human alphaherpesvi...
P09245  415 IDITFIMPMGVFQAnsmDRYTRhAGDFSt---vSEQDPRQFpPQGIFFYNKDGILTQLTLRDAMGTICHSSLLDVEATLV 491  Human herpesvirus 3...
Q9E6P8  412 VDLTFIMPLGIYQKr-gDRYARhIGDYApgpgcNVGDIRIFpPREIYFYNKDNQVISLSLSDAIGTLCHSSFLDVEATVG 490  Marek's disease her...
Q6UDI4  415 VDLTFFFPLGLFKPh-kDRYAI-GGLILpdtaeAAVDGRLFpPTEMFFFDKDEQLRSVSFESSLGTVAHPIAHGIMETLQ 492  Psittacid herpesvir...
6ODM_S  398 MDLTFVLPLGLFNPv-mERFAAhAGDLVpa--pGHPDPRAFpPRQLFFWGKDRQVLRLSLEHAIGTVCHPSLMNVDAAVG 474 
6PPB_S  467 ALNq---------AFPD-PDGGHGYGLRYEQTPNMNLFRTFHQYYMGKNVAFVP---DVAQKALVTTEDLLHPTShRLLR 533 
P03226  473 SLN----------AAPApRDRRETYSLQHRRPNHMNVLVIVDEFYDNKYAAPVT---DIALKCGLPTEDFLHPSNyDLLR 539  Epstein-Barr virus ...
Q66628  471 ALQa---------AFPEaPERMEAHGLEYEQPPHMNAHRLMFDYYNGKNVAHVT---HIARKTSMSTDDLLHPSAhELLK 538  Equid herpesvirus t...
Q2HRA7  467 ALNq---------AFPD-PDGGHGYGLRYEQTPNMNLFRTFHQYYMGKNVAFVP---DVAQKALVTTEDLLHPTShRLLR 533  Human herpesvirus 8...
Q00999  463 ALGe---------AFPD-VHNLNIYGIRSEDAHTMNLYQIVYDYYDNKHVAHVH---SLAQKSMMTHEEVLHPTNhEILR 529  Herpesvirus saimiri...
O36375  467 ELQrsnladnaleAFRD--------GLRSRPMDNMNLFAHVRRFYLKRTEVVLL---PIAQKCNLSTDDLLHPTNhKLLQ 535  Alcelaphine herpesv...
F5HGT1  463 TFTe--------rGPPSePAMQRLLECRFQQEPMGGAARRIPHFYRVRREVPRT---VNEMKQDFVVTDFYKVGN-ITLY 530  Human herpesvirus 5...
P17887  463 LMKs--------ePLPTgHRFSQLCQLKITRENPARILQTLYNLYESRQEVPKN---TNVLKNELNIEDFYKPDN-PTLP 530  Human herpesvirus 6...
P06491  475 GLN------------RDpVEAANPYGAYVA-APAGPAADMQQLFLNAWGQRLAHgrvRWVAEGQMTPEQFMQPDN-ANLA 540  Human alphaherpesvi...
P09245  492 ALR------------QQhLDRQCYFGVYVAEGTEDTLDVQMGRFMETWADMMPHh-pHWVNE-HLTILQFIAPSN-PRLR 556  Human herpesvirus 3...
Q9E6P8  491 NLR------------NGkYTLSCVLGAYVTNPPALPLADASRQFFENIGEFLRDp-pRWIDECHMTVEQFLSTGN-PYLS 556  Marek's disease her...
Q6UDI4  493 ELSq---------EQWVqARPPAPMDFTIQRMSQQPPRAQMVEFLTAVATAVTAphpSATLINRRSTDQFLSHTN-PFLQ 562  Psittacid herpesvir...
6ODM_S  475 GLN------------RDpVEAANPYGAYVA-APAGPAADMQQLFLNAWGQRLAHgrvRWVAEGQMTPEQFMQPDN-ANLA 540 
6PPB_S  534 LEVHPFFDFFVHPC-----------PGARG-SYRATHRTMVGNIPQPLAPREFQESRGAQFdavTNMTHV------IDQL 595 
P03226  540 LELHPLYDIYIGRD-----------AGERA-RHRAVHRLMVGNLPTPLAPAAFQEARGQQFetaTSLAHV------VDQA 601  Epstein-Barr virus ...
Q66628  539 LEVHPLFDFYAVGA-----------PGARGvAYRATHRGMVGNIPQSLAPAGFQECRGDQFetaACLSHV------VDAA 601  Equid herpesvirus t...
Q2HRA7  534 LEVHPFFDFFVHPC-----------PGARG-SYRATHRTMVGNIPQPLAPREFQESRGAQFdavTNMTHV------IDQL 595  Human herpesvirus 8...
Q00999  530 TEVHPFFDVYAERH-----------QGAAV-QYRATHRNLSGNLPPPLAPYSFQECRGYQFevaSGLNHV------IDST 591  Herpesvirus saimiri...
O36375  536 LELHPLFDFVVERV-----------AAEEA-AFRATHRTFSGNIPQPLAPNQFQDSRGKQFeaaTSLQHA------VDDA 597  Alcelaphine herpesv...
F5HGT1  531 TELHPFFDFTHC-------------QENSEtVALCTPRIVIGNLPDGLAPGPFHELRTWEI-----MEHMrlrpppDYEE 592  Human herpesvirus 5...
P17887  531 TERHPFFDLTYI-------------QKNRAtEVLCTPRIMIGNIPLPLAPVSFHEARTNQI-----LEHAktn-cqKYDF 591  Human herpesvirus 6...
P06491  541 LELHPAFDFFVGVAdvelp--ggdvPPAGPgEIQATWRVVNGNLPLALCPAAFRDARGLEL---GVGRHA------MAPA 609  Human alphaherpesvi...
P09245  557 FELNPAFDFFVAPGdvdlp--gpqrPPEAMpTVNATLRIINGNIPVPLCPISFRDCRGTQL---GLGRHT------MTPA 625  Human herpesvirus 3...
Q9E6P8  557 MELHPAFDFFVVPGdvdlp--gphnVPQVMaSISASLRVCNCNIPLPLCNSDFRDALGQEL---ASTHHK------MSDA 625  Marek's disease her...
Q6UDI4  563 LEVHPFYDVYRVAQdlqtpsdaalfAPVEPsTLAASRRLCNGDIPLPLSSADFRSSRGRQL---AACGAM------LSSQ 633  Psittacid herpesvir...
6ODM_S  541 LELHPAFDFFVGVAdvelp--ggdvPPAGPgEIQATWRVVNGNLPLALCPAAFRDARGLEL---GVGRHA------MAPA 609 
6PPB_S  596 TIDVIQETAFDPAYPLFCYVIEAMIHGQEEKFVMNMPLIALVIQTYWVNSGKLAFVNSYHMVRFICTHMGnGSIPKEAHG 675 
P03226  602 VIETVQDTAYDTAYPAFFYVVEAMIHGFEEKFVMNVPLVSLCINTYWERSGRLAFVNSFSMIKFICRHLGnNAISKEAYS 681  Epstein-Barr virus ...
Q66628  602 TIEVVQQSAFDPNYPVICYLIEAMVHGQEEKFVMNAQLIALVIESYWTNTGRLAFVNSFHMIKFICQHLGgAAVSKEVYG 681  Equid herpesvirus t...
Q2HRA7  596 TIDVIQETAFDPAYPLFCYVIEAMIHGQEEKFVMNMPLIALVIQTYWVNSGKLAFVNSYHMVRFICTHMGnGSIPKEAHG 675  Human herpesvirus 8...
Q00999  592 TMEIIQETAFDPAYPLLCYIVESMIHGQEEKFVMNIPLIALCIQTYWNNSGRLAFINSFYMLKFICTHMGnGHISKDAYS 671  Herpesvirus saimiri...
O36375  598 TLEVIRSTAFDPTYPFICYIVEAMIHGQPEKFTMNIPFISLCINTYWDNSGNLAFINSFFMVKNICTHMGgGLINRDAYA 677  Alcelaphine herpesv...
F5HGT1  593 TLRLFKTTVTSPNYPELCYLVDVLVHGNVDAFLLIRTFVARCIVNMFHTRQLLVFAHSYALVTLIAEHLAdGALPPQLLF 672  Human herpesvirus 5...
P17887  592 TLKIVTESLTSGSYPELAYVIETLVHGNKHAFMILKQVISQCISYWFNMKHILLFCNSFEMIMLISNHMGdELIPGAAFA 671  Human herpesvirus 6...
P06491  610 TIAAVRGAFDDRNYPAVFYLLQAAIHGSEHVFCALARLVVQCITSYWNNTRCAAFVNDYSLVSYVVTYLG-GDLPEECMA 688  Human alphaherpesvi...
P09245  626 TIKAVKDTFEDRAYPTIFYMLEAVIHGNERNFCALLRLLTQCIRGYWEQSHRVAFVNNFHMLMYITTYLGnGELPEVCIN 705  Human herpesvirus 3...
Q9E6P8  626 TINAVSATFSDISYPTAFYIIEAVIHGSERNFGLLMRLVIQCIRSYWDNCKRVAFVNNFHMVAFIDTYLCsGELPEECTN 705  Marek's disease her...
Q6UDI4  634 AAAAIETTLSDPNYPVAFYVIEACLHGDETLFLESQRLVAQCIESYWVSAGGLAFVNSFAMIMYITHNLS-SLVNRNCHA 712  Psittacid herpesvir...
6ODM_S  610 TIAAVRGAFEDRNYPAVFYLLQAAIHGSEHVFCALARLVVQCITSYWNNTRCAAFVNDYSLVSYVVTYLG-GDLPEECMA 688 
6PPB_S  676 HYRKILGELIALEQALLKLA-GHETVGRTPITHLVSALLDPHLLPPFAYhdvftd--lmqksSRQPIIKIGDQNYDNPQn 752 
P03226  682 MYRKIYGELIALEQALMRLA-GSDVVGDESVGQYVCALLDPNLLPPVAYtdifth--lltvsDRAPQIIIGNEVYADTLa 758  Epstein-Barr virus ...
Q66628  682 LYRRIYGEIVALEQALVKVA-GHDDINRRHVGEYTNSLLDPSLLPPFVYnnvfga--ffnrvDRHAEVHVGNYAVDSYNd 758  Equid herpesvirus t...
Q2HRA7  676 HYRKILGELIALEQALLKLA-GHETVGRTPITHLVSALLDPHLLPPFAYhdvftd--lmqksSRQPIIKIGDQNYDNPQn 752  Human herpesvirus 8...
Q00999  672 CYRKIYGELIAIEQSLYRLA-GHENVANENIGQLINAILDKDLLPPFAYndiftn--llrksSRHPVVKIGMEEYDDDNd 748  Herpesvirus saimiri...
O36375  678 LYRKILGEVVAIKHAIVRMC-GAEQLGNNELQGYVNGLLDRQLLPPFAYrdtf-----aqldNRGARFVIGAKEHDNSQa 751  Alcelaphine herpesv...
F5HGT1  673 HYRNLVAVLRLVTRISALPGlNNGQLAEEPLSAYVNALHDHRLWPPFVThlprnmegvqvvaDRQPLNPANIEARHHGVs 752  Human herpesvirus 5...
P17887  672 HYRNLVSLIRLVKRTISISNl-NEQLCGEPLVNFANALFDGRLFCPFVHtmprndtnakitaDDTPLTQNTVRVRNYEIs 750  Human herpesvirus 6...
P06491  689 VYRDLVAHVEALAQLVDDFTlTGPELGGQAQAELNHLMRDPALLPPLVW-------------DCDALMRRAALDRHRDC- 754  Human alphaherpesvi...
P09245  706 IYRDLLQHVRALRQTITDFTiQGEGHNGETSEALNNILTDDTFIAPILW-------------DCDALIYRDEAARDRLP- 771  Human herpesvirus 3...
Q9E6P8  706 VYKDLMHHVRALRSIVRNYTvQTDPLYGQSHEELNHVLIDRTILPPLLW-------------DCDPLIYQAEGMRDRDL- 771  Marek's disease her...
Q6UDI4  713 LYAEIVAVLNSMRAAVSRFTqSGDALLQHTQEELNHLLMDPAVFPPILY-------------DCDPIIRVTGAYAARNI- 778  Psittacid herpesvir...
6ODM_S  689 VYRDLVAHVEALAQLVDDFTlTGPELGGQAQAELNHLMRDPALLPPLVW-------------DCDALMRRAALDRHRDC- 754 
6PPB_S  753 ratFINLRGRMEDLVNNLVNiyQTRVNEDHDERHVLDVAPLDEND------YN------------PVLEKLFYYVLMPVC 814 
P03226  759 apqFIERVGNMDEMAAQFVAlyGYRVNGDHDHDFRLHLGPYVDEG------HA------------DVLEKIFYYVFLPTC 820  Epstein-Barr virus ...
Q66628  759 magILNVTDRMEDLVGRFVNlyNNRVDDDHEHRFQLDVGVFRDAE------NI------------LVLEKIFYYVFLPVC 820  Equid herpesvirus t...
Q2HRA7  753 ratFINLRGRMEDLVNNLVNiyQTRVNEDHDERHVLDVAPLDEND------YN------------PVLEKLFYYVLMPVC 814  Human herpesvirus 8...
Q00999  749 qqnCINIREKMEDLVGNMVNiyQQRNNTDHSRRYVLDVGELQENT------YN------------SVLEKIFYYVLLPVC 810  Herpesvirus saimiri...
O36375  752 ---FVHALPDFENANQVAPAmyHTRNTFNWDTFEYITVSNGNNDA------DA------------ADLEKIYYYVMLPVC 810  Alcelaphine herpesv...
F5HGT1  753 dvpRLGAMDADEPL--------------------------FVDDY------RAtd--------deWTLQKVFYLCLMPAM 792  Human herpesvirus 5...
P17887  751 dvqRMNLIDS---------------------------SVVFTDND------RPsn--------etTILSKIFYFCVLPAL 789  Human herpesvirus 6...
P06491  755 ---RVSAGGH-DPVYAAAc--nVATADFNRNDGQLLHNTQARAAD------AAddrph--rgadwTVHHKIYYYVMVPAF 820  Human alphaherpesvi...
P09245  772 ---AIRVSGR--NGYQALHFvdMAGHNFQRRDNVLIHGRPVRGDT------GQgipitphhdrewGILSKIYYYIVIPAF 840  Human herpesvirus 3...
Q9E6P8  772 ---YLNVGSE--NNYAVRPWleLQDADFQRTGNVLIHNRPIRDAD------RQtfvph--haqewTTLSKIYYYVMVPSF 838  Marek's disease her...
Q6UDI4  779 ---TIRTLGERAPVVSTRDW--PPQADFGAINITLNHGPPYTARG------RAdggah--hdsewTVLNKIFYYALLPAL 845  Psittacid herpesvir...
6ODM_S  755 ---RVSAGGH-DPVYAAACNv--ATADFNRNDGQLLHNTQARAADaaddrpHRga--------dwTVHHKIYYYVMVPAF 820 
6PPB_S  815 SNGHMCGMGVDYQNVALTL-TYNGPVFADV------------------VNAQDDILLHLENGTLKDIl---------qAG 866 
P03226  821 TNAHMCGLGVDFQHVAQTL-AYNGPAFSHH------------------FTRDEDILDNLENGTLRDLl---------eIS 872  Epstein-Barr virus ...
Q66628  821 TNGHVCGMGVDFNNLALAL-AYNGPVYAPA------------------VNGADPILDHLENGTLRDLl---------qAS 872  Equid herpesvirus t...
Q2HRA7  815 SNGHMCGMGVDYQNVALTL-TYNGPVFADV------------------VNAQDDILLHLENGTLKDIl---------qAG 866  Human herpesvirus 8...
Q00999  811 TNGHVCGMGVDFENVALTL-TYNGPVFASA------------------VNQDADILDHLENGTLRDVl---------vAS 862  Herpesvirus saimiri...
O36375  811 TNGHMCGMGADFENIAIVL-GYNIPVFDIPq-----------------FNGDDTVLEHLENGPLRDIl---------iAS 863  Alcelaphine herpesv...
F5HGT1  793 TNNRACGLGLNLKTLLVDL-FYRPAFLLMPaatavstsgttskestsgVTPEDSIAA--QRQAVGEMltelvedvatdAH 869  Human herpesvirus 5...
P17887  790 SNNKACGAGVNVKELVLDL-FYTEPF----------------------ISPDDYFQ---ENPITSDVlmsliregmgpGY 843  Human herpesvirus 6...
P06491  821 SRGRCCTAGVRFDRVYATLqNMVVPEIAPGeecpsdpvtdpahplhpaNLVANTVNAMFHNGRVVV------------DG 888  Human alphaherpesvi...
P09245  841 SRGSCCTMGVRYDRLYPALqAVIVPEIPADeeapttped-prhplhahQLVPNSLNVYFHNAHLTV------------DG 907  Human herpesvirus 3...
Q9E6P8  839 SRGQCCTMGIRFDNIYATSqSVIIPDLQPDeepplgped-prhplngrNLVPNTFNVMLHNARISV------------DA 905  Marek's disease her...
Q6UDI4  846 ARGRCCSVGVEFEMVYNLInTTRLPANADDlaapea------nplhvnNLAPDSFNALLHNSGVALV-----------DA 908  Psittacid herpesvir...
6ODM_S  821 SRGRCCTAGVRFDRVYATLqNMVVPEITPGedcpsdpvtdpahplhpaNLVANTVNAMFHNGRVVV------------DG 888 
6PPB_S  867 DIRPTVDMIRVLCTSFLTCPfvtqaARVITKRDPAQSFAThEYGKDVAQTVLVNGFGAFAVADRSRE-AAETMFYPVPFN 945 
P03226  873 DLRPTVGMIRDLSASFMTCPtftraVRVSVDNDVTQQLAPnPADKRTEQTVLVNGLVAFAFSERTRA-VTQCLFHAIPFH 951  Epstein-Barr virus ...
Q66628  873 DVAPTVDMIRTLATSFLTCPvntqhARVKTRRDPGQAVAThERAKLVGQTLLVNGFAAFAISERNRP-ACETMFFPVPFH 951  Equid herpesvirus t...
Q2HRA7  867 DIRPTVDMIRVLCTSFLTCPfvtqaARVITKRDPAQSFAThEYGKDVAQTVLVNGFGAFAVADRSRE-AAETMFYPVPFN 945  Human herpesvirus 8...
Q00999  863 EIRPTVGMIRRLCTSFLTCPfitqaARIKTDRDPGQNIVThTDGKYVHQTVLVNGFAAFAIADKSRD-AAHCLFYPVPFN 941  Herpesvirus saimiri...
O36375  864 EVNPTADMLRMMIVSYLNCPqmtqvVRVKTRRDHCQNLGP-EQGAIIEHTVMVNGFVCFGIPERMKQ-VAKNMFYPVPFH 941  Alcelaphine herpesv...
F5HGT1  870 TPLLQAC--RELFLAVQFVGehvkvLEVRAPLDHAQRQG--LPDFISRQHVLYNGCCVVTAPKTLIE-----YSLPVPFH 940  Human herpesvirus 5...
P17887  844 TVANTSCIAKQLFKSLIYINentkiLEVEVSLDPAQRHGN-SVHFQSLQHILYNGLCLISPITTLRR-----YYQPIPFH 917  Human herpesvirus 6...
P06491  889 PAMLT------LQVLAHNMAerttaLLCSAAPDAGANTAS-TTNMRIFDGALHAGILLMAPQHLDHTiQNGDYFYPLPVH 961  Human alphaherpesvi...
P09245  908 DALLT------LQELMGDMAerttaILVSSAPDAGAATAT-TRNMRIYDGALYHGLIMMAYQAYDETiATGTFFYPVPVN 980  Human herpesvirus 3...
Q9E6P8  906 DALLT------LQETVNNMAerttaILYGSTPDIGSSSSS-TRHMRTFDGALHHGLLMMAYPCNDETvAAGTYFYPVPVN 978  Marek's disease her...
Q6UDI4  909 EALVAFIAAARLRQVAHTLP-----LRVSYSADPGFATID-SPNTAFTDGVLYNGLIMMNYPQYDATlVASRYFYALPVN 982  Psittacid herpesvir...
6ODM_S  889 PAMLT------LQVLAHNMAerttaLLCSAAPDAGANTAS-TTNMRIFDGALHAGILLMAPQHLDHTiQNGDYFYPLPVH 961 
6PPB_S  946 KLYADPLVAATL---HP---LLANYVTRLPNqrna-vvfnVPSNLMAEYEEWHKSP----VAAYAASCQATPGAIS-AMV 1013
P03226  952 MFYGDPRVAATM---HQ---DVATFVMRNPQqrav-eafnRPEQLFAEYREWHRSP----MGKYAAECLPSLVSIS-GMT 1019 Epstein-Barr virus ...
Q66628  952 KFYSDPMVAATL---QP---MIADYVNQIPSqrdv-lafnVPPTIMAEYEEWHKSP----MAQYARSCAPTPLSLS-TMV 1019 Equid herpesvirus t...
Q2HRA7  946 KLYADPLVAATL---HP---LLANYVTRLPNqrna-vvfnVPSNLMAEYEEWHKSP----VAAYAASCQATPGAIS-AMV 1013 Human herpesvirus 8...
Q00999  942 KLYCDPMVAATL---HP---IVAEFITEIPSqrna-vvfnLPPRLIAEYEEWHKSP----MSSYVSTCSQTPLSLS-TMI 1009 Herpesvirus saimiri...
O36375  942 RFYCDPLVAGSW---DN---HIQNYVMNNFSqrsl-eafnAPPGIMADYAEWHKAP----MAKYITSCKASTASLS-AFT 1009 Alcelaphine herpesv...
F5HGT1  941 RFYSNPTICAAL---SD---DIKRYVTEFPHyhrhdggfpLPTAFAHEYHNWLRSP----FSRYSATCPNVLHSVM-TLA 1009 Human herpesvirus 5...
P17887  918 RFFSDPGICGTM---NA---DIQVFLNTFPHcqrndggfpLPPPLALEFYNWQRTP----FSVYSAFCPNSLLSIM-TLA 986  Human herpesvirus 6...
P06491  962 ALFAGADHVANA---PNfppALRDLSRQVPL---------VPPALGANYFSSIRQP----VVQHVRESAAGENALTyALM 1025 Human alphaherpesvi...
P09245  981 PLFACPEHLASL---RGmtnARRVLAKMVPP---------IPPFLGANHHATIRQP----VAYHVTHSKSDFNTLTySLL 1044 Human herpesvirus 3...
Q9E6P8  979 ALFACHDHLAAV---RDlpgNSRTLLYRAPP---------VPPFLGANYYSTFRQP----VAQYVKESRCGPNEISyALM 1042 Marek's disease her...
Q6UDI4  983 GFYANRTIVEAT---HRgavNLGEVPEDLPL---------VPTFLGAEAYRSIRAPsymyCAKQCASGTASAGAVAyGLM 1050 Psittacid herpesvir...
6ODM_S  962 ALFAGADHVANApnfPP---ALRDLSRQVPL---------VPPALGANYFSSIRQP----VVQHVRESAAGENALTyALM 1025
6PPB_S 1014 SMHQKLSAPSFICQAKHRMHPGFAMTVVRTDEVLAEHILYCSRASTSMFVGLPSVVRREvRSDAVTFEITHEIASLHTAL 1093
P03226 1020 AMHIKMSPMAYIAQAKLKIHPGVAMTVVRTDEILSENILFSSRASTSMFIGTPNVSRREaRVDAVTFEVHHEMASIDTGL 1099 Epstein-Barr virus ...
Q66628 1020 CMHNKLSPVAFVNQAKNRIHPGFALTVVRTDEVLSENILYSSRASTSVFVGLPSVTRKEvRSDAVTFEIHHELATLNTSL 1099 Equid herpesvirus t...
Q2HRA7 1014 SMHQKLSAPSFICQAKHRMHPGFAMTVVRTDEVLAEHILYCSRASTSMFVGLPSVVRREvRSDAVTFEITHEIASLHTAL 1093 Human herpesvirus 8...
Q00999 1010 AMHLKLSPVSFICQSRHKIHPGFALTAVRTDEVVAEHIMYSSKASTSVFIGQPTVHRKEvRSDAVVFDINHELASLDTAL 1089 Herpesvirus saimiri...
O36375 1010 VMHNKLSPIAFIVQAKHKIHPGFALTVLRTDEVLAENVMFSARASTSVFVGRPTVSRREvRADAVSFEVNHELATIETGL 1089 Alcelaphine herpesv...
F5HGT1 1010 AMLYKISPVSLVLQTKAHIHPGFALTAVRTDTFEVDMLLYSGKSCTSVIINNPIVTKEE-RDISTTYHVTQNINTVDMGL 1088 Human herpesvirus 5...
P17887  987 AMHSKLSPVAIAIQSKNKIHPGFAATLVRTDNFDVECLLYSSRAATSIILDDPTVTAEA-KDIATTYNFTQHLSFVDMGL 1065 Human herpesvirus 6...
P06491 1026 AGYFKISPVALHHQLKTGLHPGFGFTVVRQDRFVTENVLFSERASEAYFLGQLQVARHE-TGGGVNFTLTQPRANVDLGV 1104 Human alphaherpesvi...
P09245 1045 GGYFKFTPISLTHQLRTGFHPGIAFTVVRQDRFATEQLLYAERASESYFVGQIQVHHHD-AIGGVNFTLTQPRAHVDLGV 1123 Human herpesvirus 3...
Q9E6P8 1043 AGYFKLSPIGLYHQLRTGLHPGIAFTVIRQDRFLADMGLFAERASESYFLGQVSVTKRP-HAGGVQFSLTQPRANVDLGV 1121 Marek's disease her...
Q6UDI4 1051 AGYFKTSPVALTHQLKSGLHPGFALTVARQDRFYADQILFARRLSESYYMGAPTTESRA-ENNSLMIDIHQPRSHVDMGL 1129 Psittacid herpesvir...
6ODM_S 1026 AGYFKISPVALHHQLKTGLHPGFGFTVVRQDRFVTENVLFSERASEAYFLGQLQVARHE-TGGGVNFTLTQPRGNVDLGV 1104
6PPB_S 1094 GYSSVIAPAHVAAITTDMGVHCQDLFMIFPGDAYQDRQLHDYIKMKAGVQT-GpPGNRMDHVGYAAGVPRCENLPGLSHG 1172
P03226 1100 SYSSTMTPARVAAITTDMGIHTQDFFSVFPAEAFGNQQVNDYIKAKVGAQR-N-GTLLRDPRTYLAGMTNVNGAPGLCHG 1177 Epstein-Barr virus ...
Q66628 1100 GYSSILVPAHVASITTDMGVHCQDLFAMYPGEQFADREMHNYLKKKVGAAQ-G-QHNGPDARHLLNAGFACHGPPGLSHG 1177 Equid herpesvirus t...
Q2HRA7 1094 GYSSVIAPAHVAAITTDMGVHCQDLFMIFPGDAYQDRQLHDYIKMKAGVQTgS-PGNRMDHVGYTAGVPRCENLPGLSHG 1172 Human herpesvirus 8...
Q00999 1090 GYSSTIVPAHAAAITTDMGIHCQDLFAMFPSEAYSNQQLNEYIKQKIGSDRvY-GMPLRDPREYMGGNRRVT-LPGLSHG 1167 Herpesvirus saimiri...
O36375 1090 SYSSVVTPAHVASITTDMGIYCQNLFSIFSNEIYDHADVNNYVARKIGVED---AVNRHNPRALIAGVGQISHPPGLVHG 1166 Alcelaphine herpesv...
F5HGT1 1089 GYTSNTCVAYVNRVRTDMGVRVQDLFRVFPMNVYRHDEVDRWIRHAAGVERpQ-LLDTETISMLTFGSMSERNAAATVHG 1167 Human herpesvirus 5...
P17887 1066 GFSSTTATANLKRIKSDMGSKIQNLFSAFPIHAFTNADINTWIRHHVGIEKpN-PSESEALNIITFGGINKNPPSILLHG 1144 Human herpesvirus 6...
P06491 1105 GYTAVVATATVRNPVTDMGNLPQNFYLGRGAPPLLDNAAAVYLRNAVVAGN----RLGPAQPVPVFGCAQVPRRAGMDHG 1180 Human alphaherpesvi...
P09245 1124 GYTAVCATAALRCPLTDMGNTAQNLFFSRGGVPMLHDNVTESLRRITASGG----RLNPTEPLPIFGGLRPATSAGIARG 1199 Human herpesvirus 3...
Q9E6P8 1122 GYTATCTPLLLRNAITDMGNTVQSLHLTRGSPPLLHQEADEFLRKVTTRGQ----RAAPQRTVPFLGTLMPNLPSGLEHG 1197 Marek's disease her...
Q6UDI4 1130 GFTASRMPAKLNTVVTDMGSRSQNLFDARYPGQFRYLEVADFIASEITDDD-S-LAMPRARPPLMLPYEAPPLPPCLERG 1207 Psittacid herpesvir...
6ODM_S 1105 GYTAVVATATVRNPVTDMGNLPQNFYLGRGAPPLLDNAAAVYLRNAVVAGN----RLGPAQPVPVFGCAQVPRRAGMDHG 1180
6PPB_S 1173 QLATCEIIPTPVTSDVAYFQTPSNPRGRA---ACVVSCDAySNESAERLLYDHSIPDPAYECRSTNNPWASQRGSLGDVL 1249
P03226 1178 QQATCEIIVTPVTADVAYFQKSNSPRGRA---ACVVSCENyNQEVAEGLIYDHSRPDAAYEYRSTVNPWASQLGSLGDIM 1254 Epstein-Barr virus ...
Q66628 1178 QLATCEVILTPVTADVSYFQSSNSPRGRA---SCVVSCEPyNAESAENFIYNHSLSDPAYEFRATVNPWASQLGSLGDVM 1254 Equid herpesvirus t...
Q2HRA7 1173 QLATCEIIPTPVTSDVAYFQTPSNPRGRA---ACVVSCDAySNESAERLLYDHSIPDPAYECRSTNNPWASQRGSLGDVL 1249 Human herpesvirus 8...
Q00999 1168 QLATCEVIMTPVTADITYFQSSNSPRGRA---SCVVSCDAyNNESAEKFLYDHSLPDPCYEFRSTINPWASQIGSLGDVF 1244 Herpesvirus saimiri...
O36375 1167 QYATCEVIPTPVTADVAYFQKSNSPRGRA---SCVVSSDInNQERAEQFLYDHSLPDPAYEYRSTVNPWASQKGSLGDVL 1243 Alcelaphine herpesv...
F5HGT1 1168 QKAACELILTPVTMDVNYFKIPNNPRGRA---SCMLAVDPyDTEAATKAIYDHREAD-AQTFAATHNPWASQAGCLSDVL 1243 Human herpesvirus 5...
P17887 1145 QQAICEVILTPVTTNINFFKSPHNPRGRE---SCMMGTDPhNEEAARKALYDHTQTD-SDTFAATTNPWASLPGSLGDIL 1220 Human herpesvirus 6...
P06491 1181 QDAVCEFIATPVSTDVNYFRRPCNPRGRA---AGGVYAGD-KEGDVTALMYDHGQSDPSRAFAATANPWASQRFSYGDLL 1256 Human alphaherpesvi...
P09245 1200 QASVCEFVAMPVSTDLQYFRTACNPRGRA---SGMLYMGD-RDADIEAIMFDHTQSDVAYTDRATLNPWASQKHSYGDRL 1275 Human herpesvirus 3...
Q9E6P8 1198 QMSICEFIPTPVSADLEYFRTPCNPRGRA---AGAIHSGE-EASDIDDVMYDHQQGDPAYPFRATNNPWASQRLSYADKL 1273 Marek's disease her...
Q6UDI4 1208 QRATCEFLITPVTADLKYFYGPANPRGRSscvACMPHEDP-SRDSVDRAMYDHTTPDAAFPSRATNNPWASQRFSLGDRM 1286 Psittacid herpesvir...
6ODM_S 1181 QDAVCEFIATPVSTDVNYFRRPCNPRGRA---AGGVYAGD-KEGDVTALMYDHGQSDPSRAFAATANPWASQRFSYGDLL 1256
6PPB_S 1250 YNITFRQTAL--PGMYSPCRQFFHKEDIMRYNRGLYTLVNEYSArlAGAPATSTTDLQYVVVNGTDVFLDQPCHMLQEAY 1327
P03226 1255 YNSSYRQTAV--PGLYSPCRAFFNKEELLRNNRGLYNMVNEYSQrlGGHPATSNTEVQFVVIAGTDVFLEQPCSFLQEAF 1332 Epstein-Barr virus ...
Q66628 1255 YNASYKQMMA--PGLYSPCRQFFNKEDLLKNNRGLYGLVNEYITrlGGAPATSGTDLQFVVINGTDVFLEQPCLFLQEAF 1332 Equid herpesvirus t...
Q2HRA7 1250 YNITFRQTAL--PGMYSPCRQFFHKEDIMRYNRGLYTLVNEYSArlAGAPATSTTDLQYVVVNGTDVFLDQPCHMLQEAY 1327 Human herpesvirus 8...
Q00999 1245 FNSQHRQMAG--PTLYSPCKQFFNKEAILKNNKLFYTLVTEYVNrlTGAPATSNTDFQYVVINGTDVFLEQPCQFLQEAY 1322 Herpesvirus saimiri...
O36375 1244 YGSRYRQVSS--PGIYSPSKPFFNKEEMLKNNRSFYTLVNEYAQrlAGYAATSCTDLQYVVINGTDVFLEQPCLFLQEAF 1321 Alcelaphine herpesv...
F5HGT1 1244 YNTRHRERLGynSKFYSPCAQYFNTEEIIAANKTLFKTIDEYLLr-AKDCIRGDTDTQYVCVEGTEQLIENPCRLTQEAL 1322 Human herpesvirus 5...
P17887 1221 YNTAHREQLCynPKTYSPNAQFFTESDILKTNKMMYKVISEYCMk-SNSCLNSDSEIQYSCSEGTDSFVSRPCQFLQNAL 1299 Human herpesvirus 6...
P06491 1257 YNGAYHLNGA--SPVLSPCFKFFTSADIAAKHRCLERLIVETGS--AVSTATAASDVQFKRPPGCRELVEDPCGLFQEAY 1332 Human alphaherpesvi...
P09245 1276 YNGTYNLTGA--SPIYSPCFKFFTPAEVNTNCNTLDRLLMEAKA--VASQSSTDTEYQFKRPPGSTEMTQDPCGLFQEAY 1351 Human herpesvirus 3...
Q9E6P8 1274 YNGVYNLSGA--SPLFSPTYKFFTPAEVCCKTRCLDKLIGEAGS--ALASFASDGEVQFKRPIGSTELTEDPCSLFQEAY 1349 Marek's disease her...
Q6UDI4 1287 YNARRGFIVT--SDFFSPLGKFMTPSRVEDKNRCLARLLRESAT--AVSSVTGNTEFQFVAPVGSNELITDPCAIFQEAY 1362 Psittacid herpesvir...
6ODM_S 1257 YNGAYHLNGA--SPVLSPCFKFFTSADIAAKHRCLERLIVETGS--AVSTATAASDVQFKRPPGCRELVEDPCGLFQEAY 1332
6PPB_S 1328 PTLAASHRVMLDEYM---SNK----QTHAPVHMGQYLIEEVAPMKRLL 1368
P03226 1333 PALSASSRALIDEFM---SVK----QTHAPIHYGHYIIEEVAPVRRIL 1373 Epstein-Barr virus (strain B95-8)
Q66628 1333 PTLSASHRALIDEYM---SYK----QTHAPVHFNQHLIEEVAPVKRLF 1373 Equid herpesvirus type 2 strain 86/87
Q2HRA7 1328 PTLAASHRVMLDEYM---SNK----QTHAPVHMGQYLIEEVAPMKRLL 1368 Human herpesvirus 8 strain GK18
Q00999 1323 PTLSASHRALLDEYM---SHK----TTHAPVHVNQYLVEEVAPMKRLL 1363 Herpesvirus saimiri (strain 11)
O36375 1322 PTLSASHRVLLDEYM---SFK----NTHAPVHMGHYFIEEVAPVKRVF 1362 Alcelaphine herpesvirus 1 strain C500
F5HGT1 1323 PILSTTTLALMETKLkggAGA----FATSETHFGNYVVGEIIPLQQSM 1366 Human herpesvirus 5 strain Merlin
P17887 1300 PLHCSSNQALLESRSk--TGN----TQISETHYCNYAIGETIPFQLII 1341 Human herpesvirus 6 (strain Uganda-1102)
P06491 1333 PLTCASDPALLRSAR---NGE----AHARETHFAQYLVYDASPLKGLa 1373 Human alphaherpesvirus 1 strain 17
P09245 1352 PPLCSSDAAMLRTAH---AGE----TGADEVHLAQYLIRDASPLRGCL 1392 Human herpesvirus 3 strain Dumas
Q9E6P8 1350 PILCATDKALLRAYS---TGT----TDNPETHLAQYLIRDASPIGGCL 1390 Marek's disease herpesvirus type 1 strain MD5
Q6UDI4 1363 PILCASDKALFASYE---NPRkavgTGARENHFAQYLIHDASPLSGVL 1407 Psittacid herpesvirus 1 Amazon parrot/1997
6ODM_S 1333 PLTCASDPALLRSAR---NGE----AHARETHFAQYLVYDASPLKGLa 1373
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap