Conserved Protein Domain Family
GCS

?
pfam03074: GCS 
Glutamate-cysteine ligase
This family represents the catalytic subunit of glutamate-cysteine ligase (E.C. 6.3.2.2), also known as gamma-glutamylcysteine synthetase (GCS). This enzyme catalyzes the rate limiting step in the biosynthesis of glutathione. The eukaryotic enzyme is a dimer of a heavy chain and a light chain with all the catalytic activity exhibited by the heavy chain (this family).
Statistics
?
PSSM-Id: 397275
Aligned: 98 rows
Threshold Bit Score: 410.385
Threshold Setting Gi: 0
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002614386 243 VYMDSMGFGMGSSCLQVTMQAANMAQARYLYDALAPLTPVMLAVSAAAPIFKGFLVDQDVRWNVISGAVDDRTFAERDEE 322 Clavispora lusi...
XP_001947007 239 VYMDAMAFGMGCCCLQMTFQACCIKEARTLYDQLTPLCPILLALTAASPVFRGYLTDVDCRWNVISGSVDCRTRQERGLE 318 pea aphid
XP_015792538 241 VYMDAMGFGMGCCCLQVTFQASNLDEARILYDQLTPLCPIMMALSAASPIQRGYLCDLDCRWSVISQAVDDRTKEELGEE 320 two-spotted spi...
ESO07411     245 IYMDCMGFGMGCCCLQVTFQACNICEARLLYDQLTPLCPIMLALSASSAIFRGYLSDIDCRWPVISASVDDRTREERGLE 324 Helobdella robusta
XP_011440387 239 IYMDCMGFGMGCSCLQVTFQACNITEARTLYDELAPLCPIMLALSAAAPIFRGHLADIDARWTVISQSVDDRTDEERGEK 318 Pacific oyster
XP_023819156 237 IYMDAMGFGMGNCCLQVTFQACSIDEARYLYDQLATICPIVMALSAASPFYRGYVSDIDCRWGVISASVDDRTQEERGLQ 316 Japanese medaka
P97494       236 IYMDAMGFGMGNCCLQVTFQACSISEARYLYDQLATICPIVMALSAASPFYRGYVSDIDCRWGVISASVDDRTREERGLE 315 house mouse
EDO46274     238 IYLDAMGFGMGCSCLQMTFQACSIEEGRHLYDQLAAVTPIVMALSAGTPVFRGYLGDLDCRWSVIAGSVDDRTPEERGLK 317 starlet sea ane...
XP_002588470 239 IYMDCMGFGMGCSCLQMTFQACNIDEARHLYDQLAPLCPIFLALSAAAPVYRGYLADVDCRWNIIAGSVDCRTREERGLE 318 Florida lancelet
EDV23289     235 IYLDAMGHGMGCSCLQVTFQACSIDEARLLYDQLCPICPIVLALSAASPIYRGFLADVDCRWNIIVGSVDDRTKEERGLE 314 Trichoplax adha...
XP_002614386 323 PyagyeffggldvpeeVKShfqalgggrglngdavvnkfgdtgvktvdgrsvqK-IPKSRYDSIDSYLGdeayrreGFFR 401 Clavispora lusi...
XP_001947007 319 P---------------LTTd--------------------------------kFvIPKSRYDSTTLYL--------SSQG 343 pea aphid
XP_015792538 321 P---------------MKFc--------------------------------kFrINKSRYDSIDSYI--------SADG 345 two-spotted spi...
ESO07411     325 P---------------LKNe--------------------------------rFvIQKSRYDSIDSYL--------SYCS 349 Helobdella robusta
XP_011440387 319 P---------------LKEn--------------------------------kFvINKSRYDSIDSYLS----------- 340 Pacific oyster
XP_023819156 317 P---------------LKNn--------------------------------kFrIYKSRYDSIDSYL--------SACG 341 Japanese medaka
P97494       316 P---------------LKNn--------------------------------rFrISKSRYDSIDSYL--------SKCG 340 house mouse
EDO46274     318 P---------------LKEn--------------------------------rFvIPKSRYDSISCYL--------SPEG 342 starlet sea ane...
XP_002588470 319 P---------------LKDd--------------------------------kFvIPKSRYDSIDCYL--------TPEA 343 Florida lancelet
EDV23289     315 P---------------LKNn--------------------------------kHrIPKSRYDSVDYYL--------CPEG 339 Trichoplax adha...
XP_002614386 402 PAY---NDINSPLNGAVYERLVSEKFDEPLARHFAHLFVRDPLVIFNERVAQDNLSDNDHFENIQSTNWQTLRFKPPAly 478 Clavispora lusi...
XP_001947007 344 EKF---NDVPLVYDETIYNKLKSADIDHQMAQHVAHLFIRDTVSLFNEKVHQDDTVEMDHFENIQSTNWQTMRFKPPP-- 418 pea aphid
XP_015792538 346 DKY---NDIPLIYDQVYYDKMVKSGVDPLIAKHIAHLFIRDPVTLYREKLDQDDENDMDHFENIQSTNWQTMRFKPPP-- 420 two-spotted spi...
ESO07411     350 DEY---NDINMVYDKDIFNTLTNNGIDRLLAKHIAHLFIRDPISVFKEKLDLDDEVDTDHFENIQSTNWQTMRFKPPP-- 424 Helobdella robusta
XP_011440387 341 PCYrccNDLDLVYDHDIYKELIAANVDEPLSKHIAHLFIRDPVSLFSEKVNQDDEKDTDHFENIQSTNWQTMRFKPPP-- 418 Pacific oyster
XP_023819156 342 EKY---NDIELIIDEEIFKQLLEAGIDKPLAQHIAHLFIRDPLSVFEEKLHLDDENESDHFENLQSTNWQTMRFKPPP-- 416 Japanese medaka
P97494       341 EKY---NDIDLTIDKEIYEQLLEEGIDHLLAQHVAHLFIRDPLTLFEEKIHLDDANESDHFENIQSTNWQTMRFKPPP-- 415 house mouse
EDO46274     343 TKY---NDIELVMDQEIYQQLVENGIDDALARHYAHLFIRDPMTLFKEHVDEDDEQYSDHFENIQSTNWQTMRFKPPP-- 417 starlet sea ane...
XP_002588470 344 QKY---NDIDLVLDQDICQQLEDAGIDRLLARHFAHLFIRDPISLFSEKIHLNDDEESDHFENIQSTNWQSMRFKPPP-- 418 Florida lancelet
EDV23289     340 QAY---NDIELVYDKEFCEQLEKAGVDSILAHHVAHLFIREPVSVFKELLEQDDVKDSDHFENIQSTNWQTMRFKPPP-- 414 Trichoplax adha...
XP_002614386 479 kdatPEelARtPGWRVEFRPLEIQLTDFENAAFSVFIALAGAAILAYNPDWYIPISK------IDANMKTAHKVDAATKE 552 Clavispora lusi...
XP_001947007 419 ----PK--ST-IGWRVEFRPCEVQLTDFENAAIVCFVVLLTRVILSYQLNFLIPISK------VDENMSKAQKRSAALTE 485 pea aphid
XP_015792538 421 ----PS--SPgIGWRVEFRPMEVQITEFENAALVVFIVLLTRIILTYRLNLLLPISK------VDENMKEAQKRDAVQRC 488 two-spotted spi...
ESO07411     425 ----PN--TD-IGWRVEFRPMEVQLTDFENAAYVVFIVLLTRVILTYKLNFVIPISKacfrffVDENMKKAQKRDACRQE 497 Helobdella robusta
XP_011440387 419 ----PN--SN-IGWRVEFRPMEVQLSDFENAAYTVFIVLLTRVILTYGLSFVIPISK------VDENMKTAHNKDAVLND 485 Pacific oyster
XP_023819156 417 ----PN--SE-IGWRVEFRPMEVQLTDFENAAYVVFVVLLTRVILSYKLDFLIPLSK------VDENMKVAQERNAVLEG 483 Japanese medaka
P97494       416 ----PN--SD-IGWRVEFRPMEVQLTDFENSAYVVFVVLLTRVILSYKLDFLIPLSK------VDENMKVAQKRDAVLQG 482 house mouse
EDO46274     418 ----PN--SP-IGWRVEFRPTEVQLTDFENAAFVTFIVLLSRVILSFDLNLLMPISK------VDANMQTGQMRDAVRQG 484 starlet sea ane...
XP_002588470 419 ----PN--SP-IGWRVEFRPTEVQLTDFENAAYVVFIVLLTRVILSYNLNFLIPISK------VDENMQEAQKRDAVRQG 485 Florida lancelet
EDV23289     415 ----PN--SD-IGWRVEFRPCEVQLTEFENAAFAAFIVLLTRVILTYGLNFYMPMSK------VDENMQTAQKRDAVRNG 481 Trichoplax adha...
XP_002614386 553 KFWFRNpttcglrnddfkaydlswfdRFTTPGNDASAAYTNGyvtq----------devsSNVTDVKMTANEIVNGT--- 619 Clavispora lusi...
XP_001947007 486 KFWFRK--------------------NIAASTSKTANVNVNSs----------------nDDASYTQMSINEIINGKt-- 527 pea aphid
XP_015792538 489 RFWFRK--------------------RIITQTSPPEASACLRaastndikncdediidndIDESCVLLTIDEIINGKs-- 546 two-spotted spi...
ESO07411     498 KFYFRK--------------------DIVTSESLCCCPASKRspqdr--------geaqsIDDEYDLFTIQEIISGKe-- 547 Helobdella robusta
XP_011440387 486 KFYFRK--------------------EIFTDCTPEEFTKCMPeccses-------kcqtkTEDQCQLMTIDEIINGS--- 535 Pacific oyster
XP_023819156 484 MFYFRK--------------------DIFKGCHPVLDGNTSAqngv----------qtdgGSDEYTLMSIDTIINGKe-- 531 Japanese medaka
P97494       483 MFYFRK--------------------DICKGGNAVVDGCSKAqss------------sepAAEEYTLMSIDTIINGKe-- 528 house mouse
EDO46274     485 KFYFRK--------------------TLKNCKPICAGKPCRPggfng---------meciPCDELNQMSIDAIINGKnde 535 starlet sea ane...
XP_002588470 486 LFWFRK--------------------EVLPPNECCEEDPKPKpaaksys-----qyngscQQEEYTKMSINEIINGQa-- 538 Florida lancelet
EDV23289     482 MFYFRK--------------------DLGKGKRFRITTYLNNsp---------------pDESEYELMSINTIINGKa-- 524 Trichoplax adha...
XP_002614386 620 DSFPGLIRMIVRYVAA------ELapkakvSELVTLQSYLQLVSMRAAGKIPTTARFLRNFVLDHPAYQRDSKVSDAINY 693 Clavispora lusi...
XP_001947007 528 GEFPGLIPLIHSYLSSme---vDT------DTHCTIQQYLKLISRRASGQIDTTASWIRRFVQDHPAYKRDSVVSDEINY 598 pea aphid
XP_015792538 547 GMFPGLMPLLRHYLLSve---iDA------ETHCTINQYLNLISCRASGKYLTPAQWIRKFVQNHSDYKKDSVVSDKINY 617 two-spotted spi...
ESO07411     548 GVFPGLMSLIERYLQSvd--dcDV------DTSCTISQYLDLIKKRASGNLLTLASWTREFVESHPDYQHDSIVPDSTAY 619 Helobdella robusta
XP_011440387 536 ADFPGMIPLINQYLNSmedmdlDV------DTRCTISNYLNLISHRASGKSETTARWMRTFVLHHQDYKQDSVVSDRINY 609 Pacific oyster
XP_023819156 532 GVFQGLIPILNCYLENme---vDV------DTRCTILNYLKLIKKRASGELMTMAKWMREFVAKHPHYKQDSVVTDKINY 602 Japanese medaka
P97494       529 GVFPGLIPILNSYLENme---vDV------DTRCSILNYLKLIKKRASGELMTVARWMREFIANHPDYKQDSVITDEINY 599 house mouse
EDO46274     536 GEFPGLIPLINKYLSDvd---vDI------DTRCTISQYLKLISRRASGELMTTARWMREFIQSHPDYKHDSVVSERINY 606 starlet sea ane...
XP_002588470 539 GGFQGLVSLMNSYLETve---iDV------DTRCSVQQYLRLIQKRASGELMTTARWIRAFVQNHPKYKYDSVVSDEIAY 609 Florida lancelet
EDV23289     525 DGFPGLVPLINDYLASls---iDF------NTRCSLYRYLSLIQKRASGELKTTAKWMRDFVASHPDYKKDSVVSEKINY 595 Trichoplax adha...
XP_002614386 694 DLVAETVAI 702 Clavispora lusitaniae ATCC 42720
XP_001947007 599 DLLMTADGI 607 pea aphid
XP_015792538 618 DLLKTIKKI 626 two-spotted spider mite
ESO07411     620 DLLKTCSDI 628 Helobdella robusta
XP_011440387 610 DLMQACidr 618 Pacific oyster
XP_023819156 603 DLMKKCDRI 611 Japanese medaka
P97494       600 SLIWKCNQI 608 house mouse
EDO46274     607 DLLNTCNKI 615 starlet sea anemone
XP_002588470 610 DLTKVSDEI 618 Florida lancelet
EDV23289     596 DLLYACNEI 604 Trichoplax adhaerens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap