5AEJ


Conserved Protein Domain Family
DAN

?
pfam03045: DAN 
DAN domain
This domain contains 9 conserved cysteines and is extracellular. Therefore the cysteines may form disulphide bridges. This family of proteins has been termed the DAN family after the first member to be reported. This family includes DAN, Cerberus and Gremlin. The gremlin protein is an antagonist of bone morphogenetic protein signaling. It is postulated that all members of this family antagonize different TGF beta pfam00019 ligands. Recent work shows that the DAN protein is not an efficient antagonist of BMP-2/4 class signals, we found that DAN was able to interact with GDF-5 in a frog embryo assay, suggesting that DAN may regulate signaling by the GDF-5/6/7 class of BMPs in vivo.
Statistics
?
PSSM-Id: 397260
Aligned: 38 rows
Threshold Bit Score: 102.728
Threshold Setting Gi: 327275913
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5AEJ_A        40 EVLESSQE-------ALHVTERKYLK--RDWCKTQPLKQTIHEEGCNSr-TIINRFCYGQCN-SFYIPRHIRKEEG---S 105
XP_003465734  54 kTMNRAENggrpphhPFKATDASEF-----SCRELRSTRFVTEGPCRSakPVTELVCSGQCGpARLLPNTIGRGKWwrlG 128 domestic guinea...
XP_003222716  55 tMNNRAQQgervpqvSLNRMEPLEF-----SCREVYSTRYVTEGLCRSikPIRELVCSGQCLpAHLLPNSIGKGKWw-rQ 128 green anole
XP_002198562  54 nTMNQAKHgg------rHIQQAPDLNdaAFSCREVRTTRFLTDGPCRSlkPVKELLCSGQCEpSHLLPNSIGRGKWw-rQ 126 zebra finch
XP_003768197  52 KTMNRAENggryphhPLEPKDASDY-----SCRELHFTRYITDGPCRSakPVTELVCSGQCGpAHLQPNAIGR-KWlwrQ 125 Tasmanian devil
XP_005994221 226 RAMEMGSGkv---keMVLPLSQTEAS--RSSCKAIPFIQNISEPKCETi-TIQNRFCFGQCS-SFYIPDSSERR-----L 293 coelacanth
XP_001372791 137 YFLFRKSSas---qeVILPIKSNEVH--QETCRTVPFSQTIIHDDCEKv-VVQNNLCFGKCR-SLRLSEASAH------H 203 gray short-tail...
XP_004047866 136 HFMFRKSPas---qgVILPIKSHEVH--WETCRTVPFSQTITHEGCEKv-VVQNNLCFGKCG-SVHFPGAAQH------S 202 western lowland...
O55233       136 RFMFRKGPaf---qgVILPIKSHEVH--WETCRTVPFNQTIAHEDCQKv-VVQNNLCFGKCS-SIRFPGEGAD------A 202 house mouse
XP_003216484 129 IFMLKAKPrs---eeVVLPIKTNEKY--QDICNTLPFSQTIAHENCENl-VIQNNLCFGKCS-SFHVPGLEDR------L 195 green anole
5AEJ_A       106 FQSCSFCKPKKFTTMMVTLNCPElQPPTKKKRVTRVKQCRCI 147
XP_003465734 129 VPAPPRCVPDRHRAQHVQLLCP--GAAPRARKVRLVASCKCK 168 domestic guinea pig
XP_003222716 129 NALDYRCIPAHSRSLRVQLTCP--NEDMRTIKIRSITACKCK 168 green anole
XP_002198562 127 GALDFRCIPAHSRTQRVPMACP--QQETRTYKFRAATSCKCK 166 zebra finch
XP_003768197 126 SAADYRCIPDRYRTQRIPLLCPG-GEEARTHKIRVVVSCKCK 166 Tasmanian devil
XP_005994221 294 LHSCSRCAPSKVRKTIVSLKCh--NGIIADREATHIEECECE 333 coelacanth
XP_001372791 204 HAFCSHCSPTKFTTKELLLNCT--GPNPVVKVVMIVEECQCK 243 gray short-tailed opossum
XP_004047866 203 HTFCSHCLPAKFTTMHLPLNCT--ELSSVIKVVMLVEECQCK 242 western lowland gorilla
O55233       203 HSFCSHCSPTKFTTVHLMLNCT--SPTPVVKMVMQVEECQCM 242 house mouse
XP_003216484 196 YTFCSHCLPTKFSMKRLEMNCT--RALPVVKVAMIVEECRCE 235 green anole
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap