Conserved Protein Domain Family
CemA

?
pfam03040: CemA 
CemA family
Members of this family are probable integral membrane proteins. Their molecular function is unknown. CemA proteins are found in the inner envelope membrane of chloroplasts but not in the thylakoid membrane. A cyanobacterial member of this family has been implicated in CO2 transport, but is probably not a CO2 transporter itself. They are predicted to be haem-binding however this has not been proven experimentally.
Statistics
?
PSSM-Id: 397259
Aligned: 49 rows
Threshold Bit Score: 251.681
Threshold Setting Gi: 158282817
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q10YZ5       230 QIKTLTSVRFILLVILVPLLIHQLSKITFVGYLVDNFMsl-pHQQAELFLNSNMEEEALVKLHQYEEKLHFKM-YLGQAP 307 Trichodesmium e...
AQL10104     194 myaSTNSAKFLALLIVVPWVIDFLVHDYVMMPFLERYVqkvplAAELLDVRRSQKLQMVKDLNIEKARYRLEV-EIGKSP 272 Zea mays
XP_002867316 208 RYASSKSAKFLAVLILIPWALDFLSHDYVLMPFLDRYVktvplAAQALDVRRNQKLEMVKELNREKARYRLEV-EIGKSP 286 Arabidopsis lyr...
XP_018675375 203 RYASTSSAKFVALLILVPWALDFVVHDFVLMPFLDRYVktvplAAEMLDVRRQQKLEMIKTLKLERARLRLEV-EIGKSP 281 wild Malaysian ...
ERN12584     190 RYASRSSAVFLAVLVLVPCALDFVVHDYVLMPFVDRYVekvplAAALLDVRKSQKLEMIKTLKIEKARYRFEA-EIGKSP 268 Amborella trich...
EDP08569     106 KEESQIAVRYVARLIGIPLVTGFVISRALADPILNfsl---rnNPDAFELSEMQKVEGAEAVHIEETRLRLDM-AIGRAP 181 Chlamydomonas r...
XP_005844579 225 QYESREAVKYAGTLVAVPLLVGFLVSRAVAQPVWSyae---glDPRAFAPSDIQKVEGAHELHVEELRLRMEA-SLGQAP 300 Chlorella varia...
Q6YXR1       211 RYQALASLQYMLFLLFIPWGFSSLLKIWFLEPWLKNWWn---TYQYQIFLNSFQEELALKRLQQIEELVWLDKiMVNSLK 287 Physcomitrella ...
Q0ZJ08         3 KKKAFTPLLYLASIVFLPWWIS-LSLNKSLESWVTNWWn---TRQSETFLNDIQEKSILEKFIELEELFLLDE-MIKECP 77  wine grape
Q2VEG5         3 KKKAFTPLFYLASIVFLPWWIS-FSVNKCLESWVTNWWn---TGQSQIVLNNIQEKSLLEKFRELEELLFLDE-MIKEYS 77  potato
Q10YZ5       308 ElfpelyesgkeiteIPkserEELIEHKVEKKAQEIALEYKAKGNNGIKNIFCDFISLITFVIIISTRKRELEVLKSFMD 387 Trichodesmium e...
AQL10104     273 P--------------LS----DEEVWHELREKAIELRDDWRLENRNAFANIWSDTVYGIVLFLLMCFNQSKVAMLKFTGY 334 Zea mays
XP_002867316 287 P--------------LS----DDELWWEMRGKALELRDEWRLENRKAFANIWSDMVFGISLFVLLYANQGRVALLKFTGY 348 Arabidopsis lyr...
XP_018675375 282 P--------------LS----DEDIWVELRHKAIDLRDEWRLENRKAFANIWSDMVYSITLFILIYFNKSKVALLKFTGY 343 wild Malaysian ...
ERN12584     269 P--------------LS----DEEIWFELRHKALELRDEWRLENRKAFANIWSDMVFGIALFVLIFFNQSKVALMKFTGY 330 Amborella trich...
EDP08569     182 P--------------MT----ELQMFEHLAEFAAEVQEEERHHNETILINAVSDSVSFATFAGILAQPTRSREATKNTLA 243 Chlamydomonas r...
XP_005844579 301 P--------------LS----DPQIHEHLHHSAIRLDKEFREDNKRAMLNVVSDTTSATVFFVMLARQVPQRQILFRTIG 362 Chlorella varia...
Q6YXR1       288 E--------------PQ----SQDLNIEIHQKTIQLVKIYNENSLNTLLHLLTDIVYVITLSAVFILGKQRLAILNSWIQ 349 Physcomitrella ...
Q0ZJ08        78 E--------------TH----LQKLRMGIHKETIQLIKMYNEDPIHTILHFSTNIICFVILSGYSILGNEELLILNSWIQ 139 wine grape
Q2VEG5        78 E--------------TH----LEEFGIGIHKETIQLITIQNENRMDTILHFSTNIIWFGILSGYSILGKEKLVILNSWAQ 139 potato
Q10YZ5       388 DVVYGLSDSAKAFIIILLTDMFVGFHSPHGWEVILENITRHFGLPESRDFNFLFIATFPVILDAVFKYWIFRYLNRSSPS 467 Trichodesmium e...
AQL10104     335 KVLNNISDSGKAFLIILVSDILLGYHSESGWHTLVEVILEHYGLEADEAAVTFFVCLVPVAFDVYIKYWVYKYLPRLSPS 414 Zea mays
XP_002867316 349 KIINNISDTGKAFLIILITDIFLGYHSESGWETLLEIIMEHYGLEVEQSTITIFICLVPVIMDACVKLWLFKFLPRLSPR 428 Arabidopsis lyr...
XP_018675375 344 KLLNNISDTGKAFLIILITDIFLGYHSESGWQALIEIILEHYGLEIDKAAITIFICSVPVVIDACVKLWLFRFLPRLSPN 423 wild Malaysian ...
ERN12584     331 KIFKNVSDTGKAFLIILVTDIFLGYHSESGWQTLIEIILEHYGLEVDQSAITIFISVVPVVIDACVKLWLFKFLPKLSPK 410 Amborella trich...
EDP08569     244 RLFYGLSDIAKAVLIILVADTLLGYHSEEGWHGLIELVAGHYGIEPSEEGVVIFVGVVPVIIDVLFKYWIFIGLNRISPG 323 Chlamydomonas r...
XP_005844579 363 RVFTGLSDTAKAFLIILTTDILLGYHSEEGWTAFLRIFSGHYGLEAEGESLKIFVATVPVFFDSLFKVWIFIGLNKQDPA 442 Chlorella varia...
Q6YXR1       350 ELFYSLSDTMKAFSILLLTDLCIGFHSPHGWEIVIGSFLEHLGFAHNKHIISCFVSTFPVILDTVFKYWIFRHLNRISPS 429 Physcomitrella ...
Q0ZJ08       140 QFLYNLSDTIKAFSILLLTDLCIGFHSPHGWELMIGSVYKDFGFAHNDQIISGLVSTFPVILDTILKYWIFRYLNRVSPS 219 wine grape
Q2VEG5       140 EFLYNLSDTAKALCLLLVTEFFLGYHSPPGWEFAIRSIYNEVGVVANEQTITILVCILPVIFDTCFKYWLFRYLTSLSPS 219 potato
Q10YZ5       468 AVATYKNMNE 477 Trichodesmium erythraeum IMS101
AQL10104     415 VGNVLDEIkr 424 Zea mays
XP_002867316 429 VSNIFQEMKr 438 Arabidopsis lyrata subsp. lyrata
XP_018675375 424 VSNIFQEMKr 433 wild Malaysian banana
ERN12584     411 VSNIFREMRr 420 Amborella trichopoda
EDP08569     324 AVVTIKvvdr 333 Chlamydomonas reinhardtii
XP_005844579 443 AAVTLKQMDr 452 Chlorella variabilis
Q6YXR1       430 IVATYHTMNE 439 Physcomitrella patens
Q0ZJ08       220 LVVIYHSMND 229 wine grape
Q2VEG5       220 ILLIYDSITE 229 potato
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap