Conserved Protein Domain Family
IL12

?
pfam03039: IL12 
Interleukin-12 alpha subunit
Interleukin 12 (IL-12) is a disulphide-bonded heterodimer consisting of a 35kDa alpha subunit and a 40kDa beta subunit. It is involved in the stimulation and maintenance of Th1 cellular immune responses, including the normal host defense against various intracellular pathogens, such as Leishmania, Toxoplasma, measles virus and HIV. IL-12 also has an important role in pathological Th1 responses, such as in inflammatory bowel disease and multiple sclerosis. Suppression of IL-12 activity in such diseases may have therapeutic benefit. On the other hand, administration of recombinant IL-12 may have therapeutic benefit in conditions associated with pathological Th2 responses.
Statistics
?
PSSM-Id: 397258
Aligned: 8 rows
Threshold Bit Score: 334.091
Threshold Setting Gi: 821478324
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q924V6         6 KCLLLTSLVL---LVSCSLARNLPRASPAPVTepvqCFNHSQTLLRAVNSELHKAIQMLAVYSCTPEEIDHEDITKDKTS 82  domestic guinea...
XP_012663276   6 SLLLVAILVL---LDHLSLARNLPRPTPEPGR----CHQHSQKLLEAVSTTLQKARETLNSSSHTSEEIDHEDITKDKTS 78  small-eared galago
Q29053         6 NLLLVATLVLlnhLDHLSLGRSLPATTAGPGMf--kCLNHSQNLLKAVSNTLQKAKQTLEFYSCTSEEIDHEDITKDKTS 83  pig
ELV13320       1 -LLLAATLVL---LHHGTLARNLPTAMPGPGKf--gCLSHSQNLLTAISNTLQKARKNLEFYSCTSEEIDHEDITKDKTS 74  Chinese tree shrew
P43431         6 YLLFLATLAL---LNHLSLARVIPVSGPa------rCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTS 76  house mouse
XP_007502539   5 HIFLIATLIG---LSQIHWATSLPVPQPEPSMp--qCLTASKNLVEATNEILQKSRKILELYPCSLEEIDHEDITKGRSD 79  gray short-tail...
XP_012402488  55 dtFLIAILIG---LSQVNWVKSIPVIQSEPSMh--qYLRGSKNLLGTVTETLQQARQKLELYSCSLEEIDHEDITE--SN 127 Tasmanian devil
XP_005325791   6 sLLLLASLVL---LEHLGSARNLPRSTPVPAVsq-eCHNLSQTLLSTVDSALQNAIEILEHYPCSAEEVNHEDITKNRTN 81  thirteen-lined ...
Q924V6        83 TVKACVPLELVKNESCLASGHISFTTNGSCLASGKTSFMMALCLNSIYEDLKLYQLEFKNMNAQLLMDPQRQIFLDQNML 162 domestic guinea...
XP_012663276  79 TVRACIPLELTKNESCLASRETSFIPNGKCLTSRKTSSMMTLCLSSIYEDLKMYQVEFKAMNEVLSMYPINQTILDQNLL 158 small-eared galago
Q29053        84 TVEACLPLELATNESCLAARETSLITNGNCLTSGKTSFMTTLCLSSIYEDLKMYHVEFQAMNAKLLMDPKRQIFLDQNML 163 pig
ELV13320      75 TVKACLPLELITNESCLASRETSFKTNGSCLAPEKTSHMMTLCLSSIYEDLKMYQVEFKAINAQLWMDPERQILLDQNML 154 Chinese tree shrew
P43431        77 TLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGML 156 house mouse
XP_007502539  80 TVRACLPPEFIK--------------NGSCLVSTETLFIKDLCLRSIYEDLETYKAEFNVIKKTLTKDPAKQISVDLNML 145 gray short-tail...
XP_012402488 128 TGRVCLPPELIK--------------NGSCLDSKEKLSVK-LCLKSIYKDLETYKTEFKVVEETLAKDPTRQISLDQNML 192 Tasmanian devil
XP_005325791  82 TVKACLPQELAQNENCLASRETSFIIkgssltsgrtswntTLCFSSIYEDLKMYQLELKAINEKLLMDPKGQIYEDKALL 161 thirteen-lined ...
Q924V6       163 SAIDELIQALNGSDVTVPQKLSLE--EPDFYKIKMKLCILLHAFRIRAVTIDRVMSYLTSS 221 domestic guinea pig
XP_012663276 159 TVMEKLMQDLNSTSETVMHPSSHE--ETNFYKTKVKLFVLLHAFRIRAVTIDRVMSYLNSS 217 small-eared galago
Q29053       164 TAITELMQALNFNSETVPQKPSLE--ELDFYKTKIKLCILLHAFRIRAVTIDRMMSYLNSS 222 pig
ELV13320     155 TAIDELMQALNFNSDTVPRSYSLE--EPDFYKTKIKLCILLHAFRVRAVTIDRVMSYLNTS 213 Chinese tree shrew
P43431       157 VAIDELMQSLNHNGETLRQKPPVG--EADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA 215 house mouse
XP_007502539 146 AAIEEMMQALNFNSKNVPLISSPK--ESDFYKTKVKLCVLLHAFQTRTVTIDRMMNYL--A 202 gray short-tailed opossum
XP_012402488 193 AAIDEMMQALNFSSENMTVTPSPK--EPDFYKAKVKLCLLLHAFRIRVVTIDRMRNYLcfl 251 Tasmanian devil
XP_005325791 162 AAVDYLMQAVNVNNETVPQTPSPEapSPNLYRTKTKLCILLHALRIRAVTIDRVMSYLNSS 222 thirteen-lined ground squirrel
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap