Conserved Protein Domain Family
Perilipin

?
pfam03036: Perilipin 
Perilipin family
The perilipin family includes lipid droplet-associated protein (perilipin) and adipose differentiation-related protein (adipophilin).
Statistics
?
PSSM-Id: 397257
Aligned: 35 rows
Threshold Bit Score: 303.828
Threshold Setting Gi: 1270743892
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003213274   13 AEEQQQS---IGTRVASLPLVSSACGIVSSAYSSTKESHPYVRSVCDAAEKGVKTLTAAALSGAQPILTKLEPQISTANE 89  turkey
XP_012397482   17 EQQPQAQdrdLVSRVINLPLVSTTFARASAAYSSVKENHPYLNSLCGLAERSLQGLTTRAAQGAQPLLNLLEPQITSVNK 96  Tasmanian devil
M0R7Z9         30 GELDQHN---VVKRVVALPLVRATCTAVSGAYNSAKDRHPLLGSACRFAEHCVCSVATCALDHAQPLLEHLQPKLATVND 106 Norway rat
XP_008120454   16 TRDDRLC---VIKKVAELPLVSSTYEMVSATYTSAKKSHPAIQAVCDMAEVGVKAIATTAASGAQPFLDKLEPQIAAVDT 92  green anole
10_pfamImport   1 TFITNDN---ALNRVASLPIVASTWNAMQSYYATVKKTYPNVSPYLEAAENLTVSAANLALETSRPVVDRFG---NTVNS 74 
XP_012397830   13 NHPEQEN---VLQRVFQLPVVSGTCECFQKTYTSTKEAHPLVASVCNAYEKGVQGASNLAAWSMEPVVRRLSTQFSAANE 89  Tasmanian devil
Q8CGN5         13 DLPEQEN---VLQRVLQLPVVSGTCECFQKTYNSTKEAHPLVASVCNAYEKGVQGASNLAAWSMEPVVRRLSTQFTAANE 89  house mouse
XP_023604391   13 DCPEQEN---VLQRVLQLPVVSGTCECVQKTYTSTKEAHPLVASVCNAYEKGVQGASSLAAWSMEPVVRRLSTQFTAANE 89  little brown bat
XP_003788855   13 DFPEQES---VLQRVLQLPVVSGTCECVQKTYTSTKEVHPLVASMCNAYERGVQGASSFAAWSMEPVVRRLSTQFTAANE 89  small-eared ga...
NP_001107246   15 SEQDQQS---AVQRVAALPLIRATCTAVSEAYSAAKDRHPLLGSACRLAEHCVCDLTTRALDHAQPLLSHLQPQLATVND 91  sheep
XP_003213274   90 YACKGLDKLEEKLPILQQPTEKLISDTKQLVTstvtgardvltSTVAGAKDAVSSRVTGVMDMTKGAVQGSVELTKSAVS 169 turkey
XP_012397482   97 YACKGLDKLEEKLPFLRQPSQEVVTSAKDA----------------------VTSSVTGVVGLAQKGRRWSVDLTRSVVT 154 Tasmanian devil
M0R7Z9        107 LACRGLDKLEEKLPFLQQPSDTVVTSAKDA----------------------VAKSVTGVVDLAQRGRRWSGELRRSVS- 163 Norway rat
XP_008120454   93 LACKSLDVLQERFPVVQQTVEKVVSNAKGL----------------------LTESLAPVYTKVTEAAQESIEMASSTVR 150 green anole
10_pfamImport  75 YANKGLDTLESKVPIITKEPEEVLFQF----------------DVISHLCNKIVVYINAKVSI--GSCLNECERHVLHCY 136
XP_012397830   90 LACRGLDHLEEKIPALQYPPEKIASELKDTIS-----------TRIRSARNSFSVPIASTSDKILGAALAGAELAWGMAQ 158 Tasmanian devil
Q8CGN5         90 LACRGLDHLEEKIPALQYPPEKIASELKGTIS-----------TRLRSARNSISVPIASTSDKVLGATLAGCELALGMAK 158 house mouse
XP_023604391   90 LACRGLDHLEEKIPALQYPPEKIASELKGTIS-----------TRLRSARNSISVPITSTSDKVLGAALTSCELALGVAK 158 little brown bat
XP_003788855   90 LACRGLDHLEEKIPALQYPPEKIASDLKDTIS-----------TRLRSARNSISVPITSTSDRVLGAALSSCELAWEVAK 158 small-eared ga...
NP_001107246   92 LACRGLDKLEEKLPFLQQPSETVVTSAKGV----------------------VASSVTGMVGLARQGRRWSVELKRS--- 146 sheep
XP_003213274  170 SGVT-------------TVMGSTVGQMVASGVGSMLEKSEELVDHYLPMTDEELAKLATA--VEGFEPEQ---QKKQQSY 231 turkey
XP_012397482  155 SGVD-------------TVMGTRMGQMVTNGVDVMLDKSEELMDHFLPMTDEELDELAAA--AEGGTLAPg-dDQHETSY 218 Tasmanian devil
M0R7Z9        164 -----------------QAMDTVLRRSVSQAMDTVLGKSEELVDHFLPMTEAELVALATE--SQGPEVGSveeQRQKQGY 224 Norway rat
XP_008120454  151 NGVH-------------TVMETSMGQMVSNGVSEMINKSDIWIDKYLPITDSELAALAASaaLEVSDMPPliiQTKDQKY 217 green anole
10_pfamImport 137 KSLNqieflynyfkwmyNITKSTATSLINNKVEGALEVTERYVEYYLPKDEDEEEDEEGE--ENDPEA------KKQPS- 207
XP_012397830  159 DTAD-------------YASSTRVGQLAAGGADLALSNVEKVVNYLMPAPKENP---APV--LEHPSPSQvqqKLPKPSF 220 Tasmanian devil
Q8CGN5        159 ETAE-------------YAANTRVGRLASGGADLALGSIEKVVEFLLPPDKE-----SAP--SSGRQRTQk-aPKAKPSL 217 house mouse
XP_023604391  159 DTVE-------------YAAKTRVGRLASGGAELAVGGMEKVVEFLIPPAKDE----SAP--VPGRQQAQk-pPKTNRSL 218 little brown bat
XP_003788855  159 GTAE-------------YATNTRVGRLASGGADLALGGIEKVVEFLLPPAEEDS----AP--AVGCQPAQk-pSKAKLSL 218 small-eared ga...
NP_001107246  147 ---------------------------VSHAMDVVLEKSEELVDHFLPMTEEELAALAAE--AEGPEVGSveeQRKHQGY 197 sheep
XP_003213274  232 FVRLGSLSAKLQHRALQHSLGKLQSARSSSHDVLGQLQRALDLVEHLKQGVD---QKLQGGQEKLQQLWLEWS----TKQ 304 turkey
XP_012397482  219 FVRLGSLSSRLRQRAYQHSLGKLRQKKHQAQESFSQLHDTLEMIHYMKHGSN---HNFQGGEGRLQKLWQEWS------- 288 Tasmanian devil
M0R7Z9        225 FVRLGSLSARLRHLAYQHSLGKLRESKHRTQEMLAQLQKTLELIQHMQSRAS---PTPTFHHPKVQELCGDWS------- 294 Norway rat
XP_008120454  218 YVRLGSLSAKLRSRAYHHSLEKVQRVKQTFDMALFHLEQFMHLLRFTKQTWE---YKIQQGQEKLRQMWLEWI----RGQ 290 green anole
10_pfamImport 208 -DRIREISNKVRQRSYKRAMRKLHGVQTRSKEALSKLSFTVDLIQYAQSGLNstsAGIMDSANRANESVQNGM----NVA 282
XP_012397830  221 LQRIGTLTNNISQHTFHTTIQTLRWG----HALAKWIPGVAPLSSMAQWGVSaalEVVSRPRSTSRGNWQYNQ------A 290 Tasmanian devil
Q8CGN5        218 VRRVSTLANTLSRHTMQTTAWALKQG----HSLAMWIPGVAPLSSLAQWGASaamQVVSRRQSEVRVPWLHNL----AAS 289 house mouse
XP_023604391  219 MSRVGNLANTVSQHTFQTTKQVLKQG----HALAMWIPGVAPLSSLAQWGASaasQVVIRRPSEVRVPWLHNLaaaaAAA 294 little brown bat
XP_003788855  219 MSRVGALTHTLSQHTVQTTAWALKQG----HALAMWIPGVAPLSGLAQWGVSvamQVVSQQKNEVQAPWLHKL----TTA 290 small-eared ga...
NP_001107246  198 FVRLGSLSTRLRHLAYEHSLGKLRQKKHHAQDTLAQLQETLELIHRMQCGVT---PITPARPGKVHELWEDWS-----QR 269 sheep
XP_003213274  305 Ps---GGKE---LVPPATV--ESGV-LVLLQGLAQQLHSTCQP------LVCSLQGLPA--GIQDTAAQ-VRHNVEELRA 366 turkey
XP_012397482  289 -----HQDK---ESYQSQV--ESQT-LDLSRDLTQELQATCET------LAASVQGLPP--AVQAKVLE-VQQSVEELHR 348 Tasmanian devil
M0R7Z9        295 Pcl-------enGYRHSQV--ELET-LALSRSLTLELQSAVDA------LAGCVRGLPP--SAQAKVAE-VQRSVDALQA 355 Norway rat
XP_008120454  291 Pg--qSAIS---EPSQAEM--ESQA-LQVSQTITRQMQANCLK------LLTDMEGLPD--ALKEKVQE-AYSSLEEVQS 353 green anole
10_pfamImport 283 K----SNLQvvtDSINKQV--EENV-LNRARILSRQLSDTCQW------SIRYIQNSPQlqPLLKKANQ-VKDASDDLYQ 348
XP_012397830  291 QdeeeDEEE---EEEEEEE--EDEE-NLEMRKEENKLNETMPSnq--slLGSVVHTLQS--AYLTTVST-VKWAPFAIWN 359 Tasmanian devil
Q8CGN5        290 QdeshDDQT---DTEGEET--DDEEeEEESEAEENVLREVTALpnprglLGGVVHTVQN--TLRNTISA-VTWAPAAVLG 361 house mouse
XP_023604391  295 ReadhDDQT---DSEGDEAkeKEKEkEDSDSETEEQLSEAADLarpqglLGSAVHTLQK--AVQGTISA-MLWVPTTVLG 368 little brown bat
XP_003788855  291 Qed-hDDQT---DTEEEET--EEEE----LKAEENKFSEVALPspr-glLGSVAHTLQK--TLQSTISA-VTWAPVAVLG 356 small-eared ga...
NP_001107246  270 Ple-------ngRRRHSQA--ELET-LVLSRNLMRELQSTVDA------LETSVRGLPp---SAQEKVAeVRRSVDALQA 330 sheep
XP_003213274  367 SLTSATSLQELTGSAVTRARAH--ATKARELMDELVEHVAHNTPLSWLVG-----PFAPSV 420 turkey
XP_012397482  349 AFSTARSFHDLPPAVLAKGRGH--MMQAHTTVDELLEFVIQSIPLPWLVG-----PFSPLI 402 Tasmanian devil
M0R7Z9        356 TFADAHCLGDVAPTALAEGQDS--VAQAHACVDEFLDLVLRAMPLAWLVG-----PFAPIL 409 Norway rat
XP_008120454  354 ALSNAQTFQDIPSGILSQSPEK--IGKAQHAVHEVMEYVTRTPPVTWVAG-----PLSAGV 407 green anole
10_pfamImport 349 MFANKTSLSQLPTTLMVSARPK--IQFVEESLLQILQKMSDQPPIAWLTPrvdfdPFAELS 407
XP_012397830  360 NTAGRLLHLTSGQETFAKGRAMslSDALKGVTDNVVDTVVHYVPLPRLS------LMEPES 414 Tasmanian devil
Q8CGN5        362 TVGRILHLTPAQAVSSTKGRAMslSDALKGVTDNVVDTVVHYVPLPRLS------LMEPES 416 house mouse
XP_023604391  369 TAGRMLHLTSAPAATSTKSRAMslSDALKGVTDNVVDTVVHYVPLPRLS------LMEPES 423 little brown bat
XP_003788855  357 TAGRVLHLTPARAVPSTKGRAMslSDALKGVADNVVDKVVHYVPLPRLS------LMEPES 411 small-eared galago
NP_001107246  331 AFADARRFGDLPAAVLAEGRGS--MARAHACVDELLELVVQAMPLPWLVG-----PFAPIL 384 sheep
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap