Conserved Protein Domain Family
PSS

?
pfam03034: PSS 
Phosphatidyl serine synthase
Phosphatidyl serine synthase is also known as serine exchange enzyme. This family represents eukaryotic PSS I and II which are membrane bound proteins which catalyzes the replacement of the head group of a phospholipid (phosphotidylcholine or phosphotidylethanolamine) by L-serine.
Statistics
?
PSSM-Id: 397256
Aligned: 60 rows
Threshold Bit Score: 254.412
Threshold Setting Gi: 225632055
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002141760                   97 PHPIFWRFLLGLSILYLSFLVFLLFQDVESILSALR-NIDFS-LDKSTVE---VNYTEGsCSLLdws----ngILYNVRQ 167 Cryptosporidium muris RN66...
XP_004030343                   58 PNEAFWRGVLRFCLIYLCALVFLCFQNNIDVRSLFK-YLYPE-LGQPVPHs-mHTYDDN-CDL----------EFENILD 123 Ichthyophthirius multifiliis...
Q23DR8                         58 PNEAFWRGVLRFCLIYVCSLVFLSFQNTKDARNIFK-HLDPE-LGKQVSKd-yHTYDDN-CEL----------EWDNILD 123 Tetrahymena thermophila SB210...
ESS36008                      226 PHPGFWRVVHGMCVVHLIVMVVLLVVDEETGRHALE-LLFPEiAG-KREEifaGTLVVD-CRI----------NASTIHR 292 Toxoplasma gondii VEG...
CBJ31973                      126 PHPGIWRIVHGVGMLYLFAVSVLLVHPKDEAQRLLA-IFIPDvKGYTLSR---FEAGSLeCEL----------SASAVIG 191 Ectocarpus siliculosus...
A0D008                         99 PHPLFWRLLQSWACVYMMSIVFLIYFTPEQLQQFLQqFIDPK-LGRPLPS---KSYAED-CRFYtpen--ehsKFYNLTS 171 Paramecium tetraurelia...
WGS:AAGF:cds.TTHERM_00190960A 125 PHPSLWRMLQALGMCWLTVVVFALFFNRDDIQTFLKsFVDPE-LGQPLQD---KNFSED-CDIYtpgn--pkgDFYNLTD 197 Tetrahymena thermophila SB210...
EGR34121                       51 PHPAIWRMLQALGICWLICVVFALFMNRDDLQYFLKkFVDEN-LGKPLPE---KNYAEN-CQIYtpdn--prgPFANVID 123 Ichthyophthirius multifiliis...
WGS:AAFB:cds.EHI_009800A      102 PHPMFWKFIQGVGLCYLMLICFLLFQNVNDVRQWLK-NIDPK-LGVPLPE---REYAID-CRLYtpelpckwnNFKNVL- 174 Entamoeba histolytica HM-1:IMSS...
CAX64387                       56 kisiltKILNYLILIYYVIIMFLHFFSTSEVRTILR-FLNKN-IEFHAVE---KSYMEN-CN-----------NLANISD 118 Plasmodium falciparum 3D7...
XP_002141760                  168 RL-DFFAFAHFFGWFVKTLILRDNFLLWFNSIFFECLELTFKHILPNFHECWWDHLILDIFGCNFLGIIAGNIFIRKIKL 246 Cryptosporidium muris RN66...
XP_004030343                  124 NF-DHYFLIHLINWFFASLIVRDAYILHSWSILDELIELSAQHVLPHFRECWWDHVFLDVLLSNTTAIILGLYVVDFLGF 202 Ichthyophthirius multifiliis...
Q23DR8                        124 NF-DHYFQIHLINWFCATLIVRDPYILHTWSILDELIELSAQHILPHFRECWWDHVFHDVILSNTTAIVIGLLVCKLFKL 202 Tetrahymena thermophila SB210...
ESS36008                      293 QLtSVWFVSHVVGWLVKMVILRHWGFCLIYSLCFELGELSFHWLVPELCECWWDSIFIDALLSNVCGMFLGVLFMKLVNL 372 Toxoplasma gondii VEG...
CBJ31973                      192 QLrEVWFLAHLVGWWCKMCLFRDWGVCWVLSVGFELLELSMGWLVPQFHECWWDSLIIDLLGANVLGMTLGLYTLRFLET 271 Ectocarpus siliculosus...
A0D008                        172 SF-DVFVPAHIFGWTVKMWILRDFKLAMIQQIAFEFMEITFRHWLPNFWECWWDHVILDIIVCNTGGIVVGYYTMKLFGM 250 Paramecium tetraurelia...
WGS:AAGF:cds.TTHERM_00190960A 198 KL-DVFFVAHFIGWMVKMFICRDFKLCMIQSILFEFLEITFRHWLPNFYECWWDSIIFDIILCNSGGIIAGWWLMQKFEM 276 Tetrahymena thermophila SB210...
EGR34121                      124 SI-DVFFTAHFIGWLVKMFICRDFLMCMIQSVLFEFLELSLKHWLPNFAECWWDSVFFDILICNTGGIVVGWYLMNKFQM 202 Ichthyophthirius multifiliis...
WGS:AAFB:cds.EHI_009800A      175 -F-DEFVIYHFVGWWARCVICRDWKLTWFNSILFEFMELSFQHILPNFHECWWDHIILDVFGCNALGIWLGSKTLQYFEL 252 Entamoeba histolytica HM-1:IMSS...
CAX64387                      119 KI-DWFVCAHLWGWFAKGMIIRNFFLLNINSVIFELIELRFQHILPNFYECWWDHIFLDVLSCNLIGIVASILFMKYFNI 197 Plasmodium falciparum 3D7...
XP_002141760                  247 YQYNWhssyslgsfnklddTSMKsdisivgatskttknlsdftDNTnflfsnlrskyrevgsssensifnnKKPKkdily 326 Cryptosporidium muris RN66...
XP_004030343                  203 EKYDW--------------LG--------------------------------------------------RKGK----- 213 Ichthyophthirius multifiliis...
Q23DR8                        203 QPYDW--------------LG--------------------------------------------------RKDS----- 213 Tetrahymena thermophila SB210...
ESS36008                      373 CQYDW--------------LGRY------------------------------------------------PQDQ----- 385 Toxoplasma gondii VEG...
CBJ31973                      272 RTYDW--------------NSKE------------------------------------------------KSHElarsl 289 Ectocarpus siliculosus...
A0D008                        251 KEYKW--------------------------------------SLR-------------------------KENRkdswf 267 Paramecium tetraurelia...
WGS:AAGF:cds.TTHERM_00190960A 277 KEYKW--------------------------------------SLSe-----------------------aGKKKkpywk 295 Tetrahymena thermophila SB210...
EGR34121                      203 KEYRW--------------------------------------SLQ-------------------------SKYKksftq 219 Ichthyophthirius multifiliis...
WGS:AAFB:cds.EHI_009800A      253 REYNF--------------SGVS------------------------------------------------PMQKkgkif 270 Entamoeba histolytica HM-1:IMSS...
CAX64387                      198 ELYDWki---------------------------------------------------------------pDKIKpn-kk 213 Plasmodium falciparum 3D7...
XP_002141760                  327 MVIdl-wSKF-GIYTWTEYKWPKTLsNMKG------FMTFLLLTIIVQLIDLNYFFIKAELLLPVSHWILALRTICVAIC 398 Cryptosporidium muris RN66...
XP_004030343                  214 -------KNY--------KEWSIWQ-CHRR------FGALLVIFLVIICNFLCGFFLINSLWIPPKNWLNIYRLLVWFLL 271 Ichthyophthirius multifiliis...
Q23DR8                        214 -------KGF--------FDWKVWK-CHRR------FGGLLAIWFVIITNFLCGFFMINSLWIPPQNFLNLYRLLVWFLL 271 Tetrahymena thermophila SB210...
ESS36008                      386 NVS----MSL-TPFASEASDWSFYK-TPRH------LFMSIVLLMICLFSELNVFFLMAALDIPAAHYSNPLRTLYIALL 453 Toxoplasma gondii VEG...
CBJ31973                      290 RLL----AKF-SPLGWSKWRWEAFS-SLKR------TAQVFSMVAATMLLELNAFLVMNALEIPNNSNFNYMRMTVIFLV 357 Ectocarpus siliculosus...
A0D008                        268 KNL----KRLcLSPQLDKIEWKVFS-SVKR------FLLVIWFLVFMNLCDLSFFFNKFVLQINTAHNVMKFRVFPLGFF 336 Paramecium tetraurelia...
WGS:AAGF:cds.TTHERM_00190960A 296 NVK----ELFiTP-NLEKHDWKVFS-SSLR------FASVIYYMIFMNLVDLSFFFNKFVLWIRPSHPVLSFRTFMIGFL 363 Tetrahymena thermophila SB210...
EGR34121                      220 NLK----EIFiTP-NLEKHEWKMFS-SLRR------FILVMWFGIFMNLVDLNFFFNKFVIRIEPSHYILSYRTFVIGFL 287 Ichthyophthirius multifiliis...
WGS:AAFB:cds.EHI_009800A      271 RVI----GQF-TPTSWTRYHWGMFT-HWKR------FIYVIILIIYFQLFDLNSFFLKAELWLKPSHYLNLIRLIVLALQ 338 Entamoeba histolytica HM-1:IMSS...
CAX64387                      214 NIIfptiDKL----------------CRKVftnsstLLILIFLSFITNIIDLNVFFLKAEIQLHHVNLIVIARTFAIGFI 277 Plasmodium falciparum 3D7...
XP_002141760                  399 GAAATRELYEFVTntS-NNSDKV-----GIQCWVLIAIVFTESLLCWRFR 442 Cryptosporidium muris RN66
XP_004030343                  272 SNLAFKEIYTDIK--TwGTEERVknpisGKCRWITFFICFTETFISIKFS 319 Ichthyophthirius multifiliis
Q23DR8                        272 SNLAFKEIYVDID--TwGTKKRVenpisGKCRWITFFITFTEAFIALKFI 319 Tetrahymena thermophila SB210
ESS36008                      454 GVAAAAEHYEFTT----KRRDRI-----GRNKWLLIIILFVEWLVCAKYG 494 Toxoplasma gondii VEG
CBJ31973                      358 ALLACSEYYEYCS--N-PACNRL-----GQNAWLILAIMQVEILLWIKFf 399 Ectocarpus siliculosus
A0D008                        337 SIVAARDYYVYIS--D-ENVTRL-----GPNAWLMHAIVLGEWVLFFRNY 378 Paramecium tetraurelia
WGS:AAGF:cds.TTHERM_00190960A 364 AIPATREYYEYIS--N-PQQKRL-----GGICWLTQAIVYSELLVFLKNY 405 Tetrahymena thermophila SB210
EGR34121                      288 SIPASREYYEYIS--N-DNLKRL-----GGTVWLMQAIIFSEIFLFFKNY 329 Ichthyophthirius multifiliis
WGS:AAFB:cds.EHI_009800A      339 APLVFRQCYQYVI--D-KNTKDI-----GSASWILGLTLLLEGILCFKWg 380 Entamoeba histolytica HM-1:IMSS
CAX64387                      278 SGKACKEFYRFLK--EgMTPKR------AFYIFLEIIILSLEFLLAIRWK 319 Plasmodium falciparum 3D7
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap