5HCI


Conserved Protein Domain Family
ATP_bind_1

?
pfam03029: ATP_bind_1 
Click on image for an interactive view with Cn3D
Conserved hypothetical ATP binding protein
Members of this family are found in a range of archaea and eukaryotes and have hypothesized ATP binding activity.
Statistics
?
PSSM-Id: 397252
Aligned: 30 rows
Threshold Bit Score: 110.924
Threshold Setting Gi: 81858823
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5HCI_D   7 CIGMAGSGKTTFMQRLNSHLRAEKTPPYVINLDPAVLRVPYGANIDIRDSIKYKKVMENYQLGPNGAIVTSLNLFSTKI- 85  baker's yeast
Q9YDX8   7 VTGTAGAGKSSLVGALADRITSLGANVATLNLDPAAEKLPYDPSVDARDYVSVAELMDK-GLGPNGALVAAVDSLINHV- 84  Aeropyrum pernix
O58345   9 FVGTAGSGKTSLTGAFGEYLEEN-YKVAYVNLDTGVKELPYKPDIDVREFVTVEEIMKE-GYGPNGAIVESYD----RLm 82  Pyrococcus horikoshii
O28074   8 FTGTAGSGKTYMTKALADWFDLKKLDYLTVNLDPGADFLPYSADIDVREWFTLEDIMGRYNVGPNGAQIIGAD-LVSTLi 86  Archaeoglobus fulgidus
P46577  35 VLGMAGSGKTTFVQRLTAFLHARKTPPYVINLDPAVSKVPYPVNVDIRDTVKYKEVMKEFGMGPNGAIMTCLNLMCTRF- 113 Caenorhabditis elegans
Q9V3R3  28 VLGMAGSGKTTFTQKLIQHAQ-EKFNPYVVNLDPACREVPYAAHVDIRDTVNYREVMKQYQLGPNGGIVTALNMFTTKM- 105 fruit fly
Q8W586  46 VVGMAGSGKTSFLHRLVCHTFDSKSHGYVVNLDPAVMSLPFGANIDIRDTVKYKEVMKQYNLGPNGGILTSLNLFATKF- 124 thale cress
O42906  13 VVGMAGSGKTTFMQQLNAHLHSKNKPPYILNLDPAVRNLPYEANIDIRDTINYKEVMKQYNLGPNGGIMTSLNLFVTKF- 91  Schizosaccharomyces p...
Q9VU67  20 IIGPPGSGKTTYCGEALKFYRELGRQVGVVNLDPANENMSYEPVLSVMELITVEDCMEHLKLGPNGALMHCAEYLADHLe 99  fruit fly
O01426   6 VIGAPGAGKSTFCAGLTDIFSQTKRPFLTINLDPANDTMAYAPDVNITEMITVNDVMDRLGLGPNGALKYCIETLGANC- 84  Caenorhabditis elegans
5HCI_D  86 DQV---IRLVeQKkDKf-QNCIIDTPGQIECFVWSASGAIITESFAS-SFPTVIAYIVDTPRNSSPTTFMSNMLYACSIL 160 baker's yeast
Q9YDX8  85 --Ld-iREEI-DYySP--DYVVVDTPGQLELFAYRVGGPLVLRGIMG-DYNGVNIFLIDSIFIDNAISLVSALLLASSVA 157 Aeropyrum pernix
O58345  83 NKFdyyLKEI-LElESkkDYVLIDTPGQMETFLFHEFGVKLMENLPY----PLVVYLSDPEILRKPTDYCFVRFFALLID 157 Pyrococcus horikoshii
O28074  87 DDI---RDEI-QLsSS--EYVLIDTPGQLELFTLRESSRVLVNALN--PERSVMVYLFDPVVSKTPSGFLSMLFMASSAV 158 Archaeoglobus fulgidus
P46577 114 DKV---IELInKRsSDf-SVCLLDTPGQIEAFTWSASGSIITDSLAS-SHPTVVMYIVDSARATNPTTFMSNMLYACSIL 188 Caenorhabditis elegans
Q9V3R3 106 AQF---AELVrRAgERghKWCVIDTPGQIEVFNWSASGSIITEGLAT-MFPTIVVYVMDVERSACPTTFMSNMLYACSIL 181 fruit fly
Q8W586 125 DEV---VSVIeKRaDQl-DYVLVDTPGQIEIFTWSASGAIITEAFAS-TFPTVVTYVVDTPRSSSPITFMSNMLYACSIL 199 thale cress
O42906  92 DQV---LKILeKRaPTv-DHILIDTPGQIEIFQWSASGSIICDTLAS-SWPTCIAYVVDTPRATSTSTWMSSMLYACSML 166 Schizosaccharomyces p...
Q9VU67 100 DWL---LPALrKL-SAtyNYFLFDCPGQVELYTHHNAMARIFERLEReRYSLVTVNLIDSHYCSEPAKFIATLLMALNTM 175 fruit fly
O01426  85 NWL---LQKIeAN-HK--KYLIIDCPGQLELYKSEGELWKVIRFLEKsGVRLCALHLADSLYCSDPSKFISVALSTLATM 158 Caenorhabditis elegans
5HCI_D 161 YKTKLPMIVVFNKTDVCK-----ADFAKEWMTDFESFQAAIKedQd--------GYMSSLVNSMSLMLEEFYSQlDVVGV 227 baker's yeast
Q9YDX8 158 VRLGLPQVNAVSKADMLLpe--vREEVIPRLGEPGFLEFLLEkdKty------eGAGKALAEELARAIETTGFIgEVLQA 229 Aeropyrum pernix
O58345 158 LRLGATTVPALNKVDLLKee--qLEKHRKYFEDLDYLMGRLKfdPsm------qGL---MAYKMCSIMMEVLPPiRVLYL 226 Pyrococcus horikoshii
O28074 159 FRLEIPQVLVLSKSDILSer--eLERIVEWSEDPETLYDSLNl------------eRKTLNLELFLLLKEAGLFrPLIPA 224 Archaeoglobus fulgidus
P46577 189 YRTKLPFIVVFNKADIVK-----PTFALKWMQDFERFDEALEdaRs--------SYMNDLSRSLSLVLDEFYCGlKTVCV 255 Caenorhabditis elegans
Q9V3R3 182 YKTRLPFLVALNKIDLKD-----CGFVMDWMTDFEAFQEAQEeeH---------SFVSNLTRTMSLTLDTFYENlRTCGV 247 fruit fly
Q8W586 200 YKTRLPLVLAFNKTDVAD-----HKFALEWMEDFEVFQAAIQsdN---------SYTATLANSLSLSLYEFYRNiRSVGV 265 thale cress
O42906 167 YKAKLPLIIVYNKCDVQD-----SEFAKKWMTDFEEFQQAVTkdEgmssegatsGYMGSLVNSMSLMLEEFYRHlDFVSC 241 Schizosaccharomyces p...
Q9VU67 176 LRMSLPHVNVLSKADLLKkhetkLHFNVDYYTDVLDLKYLLDklDddp----amRKYRKLNAAICSMVEDYALV-SFQLL 250 fruit fly
O01426 159 VTMEMPQVNCLSKADLFSed---gtYDLEFFSHLPDVNRLLDllNevp----glEKYRKLNEAICGVISDFDLV-SFVPL 230 Caenorhabditis elegans
5HCI_D 228 SSFTGDGFDEFMQCVDKKVDE 248 baker's yeast
Q9YDX8 230 SVLEPETVTLLAAKAQQILAG 250 Aeropyrum pernix
O58345 227 SAKTREGFEDLETLAYEHYCT 247 Pyrococcus horikoshii
O28074 225 SALTGYGMEDIYDAIQEIFYG 245 Archaeoglobus fulgidus
P46577 256 SSATGEGFEDVMTAIDESVEA 276 Caenorhabditis elegans
Q9V3R3 248 SAKTGVGFTQLLTKILESVDE 268 fruit fly
Q8W586 266 SAISGAGMDGFFKAIEASAEE 286 thale cress
O42906 242 SSVTGEGMDDFLEAVKAKVKE 262 Schizosaccharomyces pombe 972h-
Q9VU67 251 DVFSTDSMLRLRNHIDKANGY 271 fruit fly
O01426 231 AVENKESMMKVIQMVDAANGF 251 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap