Conserved Protein Domain Family
Transposase_23

?
pfam03017: Transposase_23 
TNP1/EN/SPM transposase
Statistics
?
PSSM-Id: 397246
Aligned: 6 rows
Threshold Bit Score: 91.278
Threshold Setting Gi: 0
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AQK79515      545 HIFLKSWRNQ-NKKVALGTIIGCDPKQQVGGDPLGKEFWKVRLGLVLVR--DEPLIRPYNNFVVLGD 608  Zea mays
2_pfamImport    1 AVLLLSMNSK-DQVVAVGNLISRNMTHVVGGSILGDEYYCVVVHSLTDAaeDEILPRPYDHIRTLED 66  
AAN05390     1487 DVILYAVLRS-DTPVAKATIVSIDPSSLVGGQPLGVEFYEVVVNVVLKR--DALLPRPYDDMQTMAD 1550 Japanese rice
EMS50891      195 EVFLLSCVRP-HRRVAKATLQTSCTSTIVGDKALGPGCCLVLVNQVLDG--KAPLIRPLGDINTMDE 258  Triticum urartu
XP_015694167  237 EVILYSFIGPhDVPVAKATVLSTNRMTVVGGTPLGAQYCEVVVNLVLKR--NAALLRPYGSMNVIAD 301  malo sina
XP_021321582  252 dVILYTILRS-ELPVAKGTVISTNPNTIVGGQPLGNEYCEVVVDVVMKR--DAMLPRTYGGMLTMAS 315  sorghum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap