Conserved Protein Domain Family
NPH3

?
pfam03000: NPH3 
NPH3 family
Phototropism of Arabidopsis thaliana seedlings in response to a blue light source is initiated by nonphototropic hypocotyl 1 (NPH1), a light-activated serine-threonine protein kinase. Mutations in NPH3 disrupt early signaling occurring downstream of the NPH1 photoreceptor. The NPH3 gene encodes a NPH1-interacting protein. NPH3 is a member of a large protein family, apparently specific to higher plants, and may function as an adapter or scaffold protein to bring together the enzymatic components of a NPH1-activated phosphorelay.
Statistics
?
PSSM-Id: 397238
Aligned: 190 rows
Threshold Bit Score: 181.15
Threshold Setting Gi: 514776120
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9FMF5       251 WWFEDVSILRIDHFVRVITAIKVKGMRFELLGAVIMHYAGKW-LPglikeggvaiapamssaiggglglggdemsiscgs 329 thale cress
XP_002460930 234 LWIKDLVALPFDFFERIVQALRRQGMKEKYVSPVVLFYANKWvLS----------------------------------- 278 sorghum
XP_003562811 240 LWIKDLVALPLEFFRRIVQALRRQGMKEKYVSPVVLFYANKWvLS----------------------------------- 284 stiff brome
KRH14099     218 LWMRDLIALPFGFFKRVIGSLRKQGMKEKYVSPIIVFYANKWvLS----------------------------------- 262 soybean
XP_006363043 218 LWIKDLIALPFPFFKRIISSLRRQGMKEKYVSPIVLFYANKWvLS----------------------------------- 262 potato
XP_002270802 217 LWIKDLIALPFQFFKRIIGSLRRQGMKEKYVSPIIVFYASKWvLS----------------------------------- 261 wine grape
EEF28516     217 LWIKDLIALPFGFFRRIIGSLRRQGMKEKYVSPVIVFYANKWvLS----------------------------------- 261 castor bean
XP_002321176 219 LWIKDLIALPFGFFKRIIGSLRRQGMKEKYVSPIVVFYANKWvLS----------------------------------- 263 black cottonwood
EFJ13915     307 WWMQQLVELPYALFARIVAATRRQGMAERVIGQLMIKCVERWiF------------------------------------ 350 Selaginella moe...
EFJ28028     154 LWIKDLMRMPFRIFSRIIVSCTKQGLSPKNTSQLVVKYAEKWlFS----------------------------------- 198 Selaginella moe...
Q9FMF5       330 nssggssgpdwkgglhmvlsagktnghqdsvaclagLGI---------------------SPKD---QRMIVESLISIIP 385 thale cress
XP_002460930 279 ------------------------------------KKThkfwatt-------ddeavdgETDAnrrAAAILEGVIGLLP 315 sorghum
XP_003562811 285 ------------------------------------KKThkfwacsgae--ddeagagrgESDAnrrAAEILQGVVELLP 326 stiff brome
KRH14099     263 ------------------------------------KKTrqfwes---------scdkigEGGMnskASVILQGVVDLLP 297 soybean
XP_006363043 263 ------------------------------------RKThqywqdarkdgkadndvedddDDDTnekVSKILQGILDLLP 306 potato
XP_002270802 262 ------------------------------------KKTrqfwensg-----gknkdkdkDNDInnkVSIILQGVLDLLP 300 wine grape
EEF28516     262 ------------------------------------NKTrqfwen---------sgdrlgNVDAnnrVSTILQGILDLLP 296 castor bean
XP_002321176 264 ------------------------------------KKTiqywes---------sgertsDANAndkVSTILQGVLDLLP 298 black cottonwood
EFJ13915     351 ------------------------------------GRGdadqqhknrdyylwcgsqrleKLEQrsdKCRLLESMVRLLP 394 Selaginella moe...
EFJ28028     199 ------------------------------------ESCcsdfd-----------endeqRSLTdelLQEMLDCIAHLLP 231 Selaginella moe...
Q9FMF5       386 -----PQkDS-VTCSFLLRLLRAANMLKVAPALITELEKRVGMQFEQATLQDLLI--PGYnnKGe----TM-Y-DVDLvq 451 thale cress
XP_002460930 316 aesaaVAaGGaIPVAFYFALLSRSLTLELSDESRTKLREQVASNLQFARVDDLPL--PEE--EEadrsiADsR-EVRAme 390 sorghum
XP_003562811 327 vpaeaAI----LPAAFYFALLSRSLSLELKEASRARLRDLVASHLRFACVDDLPL--PEQ--EDadrsvADsP-EVMEme 397 stiff brome
KRH14099     298 vgdkaRKv---IPVGFYFALLSRSLELGLTTESKAKLQDQITSLLHFSQVENFLL--Pesga----klmSSsM-ELVTme 367 soybean
XP_006363043 307 mgekaSKv---IPVGFYFSLLSRSLQLGLTSESREKLQDQIASLLYLARMEDFLL--Pdssn----dsiSScI-ELSVmk 376 potato
XP_002270802 301 mgekaSRv---IPVGFYFALLSRSLEVGLRSDNKVKLQDQIVPLLHLAQVEDLLL--Prcgt----dsiSSsI-ELATme 370 wine grape
EEF28516     297 trekaRRv---IPVGFYFALLSRSFEVGLRSESKTKLQDQIASLLHLAQVEDFLI--Pktgt----dsvATsM-ELATme 366 castor bean
XP_002321176 299 mrekaSRv---IPVGFYFALLSRSIGIGLRNDSKVKLQDQIASLLHFAQVEDLLI--Pssrv----dsdCSsM-ELATme 368 black cottonwood
EFJ13915     395 vekqqL-----LPVSFLFRLLRHALGVGASTECRLQIETRIACQLELASVDDLLLglPlkdg----rtsKA---QLESar 462 Selaginella moe...
EFJ28028     232 fer------gaVPISFLFALLRYSVAIDAPRDCRVQIESRIACQLDLATIEDLLM--Pfksa----rqaPTlLcELDSmk 299 Selaginella moe...
Q9FMF5       452 rllehflvqeqtegsspsrmspspsqsmyadiprgnnnnggggggnnqnakmRVARLVDSYLTEVAR-DRNLPLTKFQVL 530 thale cress
XP_002460930 391 sivsnha------------------------------------asvqrrgveAVSELWDRYLVQFAG-DPKLRPERLAEL 433 sorghum
XP_003562811 398 sivsnhv------------------------------------amlqrqgaeAVAELWDRYLVQVVAcDPKLRLERLEEL 441 stiff brome
KRH14099     368 siisayvass------------------------------srvnqtpeasnyRVAELWDAYLFNIAA-DPDMGPKRFMEL 416 soybean
XP_006363043 377 sivskyvsfn------------------------------melthtpsprnyIVAELWDVYLTKIAT-DPQWSSKRFLEL 425 potato
XP_002270802 371 rifsnyvsan------------------------------mdakhtpsvnncIVAELWDVYLSLVAP-DPNMGPKRFMYL 419 wine grape
EEF28516     367 sifstyvtln------------------------------mdanntpsprnsAVAELWDSYLSLIAS-DPKMEPKRFTGL 415 castor bean
XP_002321176 369 sifstnvsln------------------------------mdtnnapsasnsTVAELWDTFLSHIAS-DPKMRPKRFMEL 417 black cottonwood
EFJ13915     463 qiaslflqqqqqqqqddrkqgg------ggshvfsssrdetllfftnieavnTVSKIWDGYLEYLGY-DPGINPVTLSDL 535 Selaginella moe...
EFJ28028     300 hvvalfmaqcra--------------------------vdsstglanwepiaNVARVWDEYLTEIGY-SGSITPTKFAEL 352 Selaginella moe...
Q9FMF5       531 AEALPESARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSMDA 580 thale cress
XP_002460930 434 IGVIPAGDRKTHNHLYEAINTYLVEHQGLSGEEKATLCGHLDCRKLSHEA 483 sorghum
XP_003562811 442 IGVVPAADRKTHDHLYEAINTYLTDHPGLCGEEKAALCGHLECRKLSHEA 491 stiff brome
KRH14099     417 IERVPPSYRQNHYPLYKTINSFLKTHSGISQDDKGAVCKYLDCQRLSQEA 466 soybean
XP_006363043 426 IETVPLSSRQTHDHLYRALSTFLMAHPDMSQEEKGLVCKYLNCQKLSQEV 475 potato
XP_002270802 420 IEIVLVSSRQTHDHLYRAMNAFLHAHPNISQEEKGMVCKYLDCQKLSQEV 469 wine grape
EEF28516     416 VETVPISCRQSHDQLYQAMSTFLQAHLDVSQEEKGLVCKYLNCQKLSQEA 465 castor bean
XP_002321176 418 IETVPISCRQSHDQLYRAMNTFLQTHLDISQEEKGAVCKYLNCQKLSQWA 467 black cottonwood
EFJ13915     536 IDVFPACARTSHDQLYKAIHVYLKSHPHVTHSERLLVCRSLNCQKLSQEA 585 Selaginella moellendorffii
EFJ28028     353 IDAVPGFVRVSHDQLYKAIHVFLKAHPTASQSERSAICRPLDCQKLSQEV 402 Selaginella moellendorffii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap