2YKQ,2YKQ


Conserved Protein Domain Family
Transposase_22

?
pfam02994: Transposase_22 
Click on image for an interactive view with Cn3D
L1 transposable element RBD-like domain
This entry represents the RBD-like domain.
Statistics
?
PSSM-Id: 397235
Aligned: 2 rows
Threshold Bit Score: 177.666
Threshold Setting Gi: 343197093
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2YKQ_A  52 RPNLRLIGVPESDVENGTKLENTLQDIIQENFPNLARQANVQIQEIQRTPQRYSSRRATPRHIIVRFTKVEXKEKXLRAA 131 human
2YKQ_A  52 RPNLRLIGVPESDVENGTKLENTLQDIIQENFPNLARQANVQIQEIQRTPQRYSSRRATPRHIIVRFTKVEXKEKXLRAA 131 human
2YKQ_A 132 REKGRVTLKGKPIRLTVD 149 human
2YKQ_A 132 REKGRVTLKGKPIRLTVD 149 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap