3BUL,2O2K


Conserved Protein Domain Family
Met_synt_B12

?
pfam02965: Met_synt_B12 
Vitamin B12 dependent methionine synthase, activation domain
Statistics
?
PSSM-Id: 397217
Aligned: 311 rows
Threshold Bit Score: 117.565
Threshold Setting Gi: 81445514
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3BUL_A          289 SIETLRNYIDWTPFFMTWSLAGK-YPRILE------------------DEVVGVEAQRLFKDANDMLD--KLSAE-KTLN 346 
CCZ98408        931 PICDVIPYIDWSYFISSWGLKGR-WPEILF------------------SSDKGEEARKLVDDAQTMLY--RIGRE-KLLT 988  Alistipes s...
WP_004328825    931 SIADVEPLIDWNFFFPAWGLKGR-VPEIFE------------------NPEHGAEARKLYDDAQKMLA--RIREE-KLLT 988  Alistipes p...
WP_014623889    931 gVAEVRPYLDWRMFYKGWGLPARtpe--------------------rmREAERAEAVRLREEAEGVLA--RMEGR-V--R 985  Spirochaeta...
CCY15354          8 gISDVTPYVNWIYFFHAWGVAPR-FAAVARlhdcpgcraawlaaqpdgDRSQAEAAAALYDDAVRMLA--RFSAD-F--H 81   Prevotella ...
WP_013445490     20 DLREIVPFIDWGFFFMAWRMSGK-YEGIETvhdclsckttwlqqfppaDRPRAEEALKLFKDAQEMLR--NMLDEkI-VS 95   Paludibacte...
WP_068690498    926 dLGELAERIDWTPFFHFWGFKGK-FPEIIY---------------------TREEAEKTYQAALEMLG--RIIAG-QEFD 980  Culturomica...
jgi:Odosp_3416  927 DLQDLIAKIDWTPFFHFWGFKGK-FPEIIH---------------------QHEEADRTYQAALEMLG--TVIAG-NEFE 981  Odoribacter...
CDA96507        950 sIDEILPYFDWRMFLAIWGIKYG--GDLPD------------------DP----IIEKTVKDGKAVLE--RFKTR-HEVI 1002 Bacteroides...
WP_014270523    934 aldELLPLVNWKMYSTSWKVPVGtS-----------------------------ESEKLISDALEMLAdpQIIRL-LESG 983  Sphaerochae...
3BUL_A          347 PRGVVGLFPANRVGDD-IEIYrDETrthVINV--SHHLRQQ--TEKT--GFAN---YCLADFVAPKLSGKaDYIGAFAVT 416 
CCZ98408        989 LNAVVGIFPAFSRGDD-IVV--ERE----GRKvvLPQLRCQsaSA-----AEN---LSLADYVLPEGEGD-DYVCLFAAS 1052 Alistipes s...
WP_004328825    989 LQGVAGIFAAVSRGDD-IVVT-GPK----DKKyiLPMLRSQapVRE----AQA---RCLADFIADEKAGRtDYIGAFALT 1055 Alistipes p...
WP_014623889    986 IEGVVGFFPARDVGED-CIGvlgwggegVIRR--LPMLRQQ--AV-Ke-GEPT---RSLVDFLPHEGH---DYLGLFVIT 1052 Spirochaeta...
CCY15354         82 TYGRVGLYPAWSDGDD-LVLrle---dgSCFA--IPCLRQQ--RVARe-GEPY---LCLADYLPPEGYGe-DRLGVFATA 148  Prevotella ...
WP_013445490     96 VNASFGVFQGYALGDD-IFIen----ngSTIT--LPMLRQQ----HPatDGFC---YSLADFVAPEN----DYVGAFATT 157  Paludibacte...
WP_068690498    981 ASLVVRFFNAHTE-NDtIIL---------DNGhrLPMLRQQ---------SDSpvcLCLSDFISPQADQPs-TIGVFCLK 1040 Culturomica...
jgi:Odosp_3416  982 ASIVVNFFDAYAE-DDeIVL---------DNGhrLPMLRQQ---------KAGqecLSLSDYICPKAYGTs-TIGLFALK 1041 Odoribacter...
CDA96507       1003 IRLSERIMNARREGND-IVIS--------GEStrFPMLRQEniDAHGesR------LSLADFVPSGHDG---PMGTFAIS 1064 Bacteroides...
WP_014270523    984 CKAVCGLFPATS--DR-MTVS--------AGTgkFHFLRNE---------STG---LCLADYVAK-ES---DTVGLFVVS 1036 Sphaerochae...
3BUL_A          417 G--------------------------GLEEDALADAF-EAQH---D--DYNKIMVKALADRLAEAFAEYLHERVRKVYW 464 
CCZ98408       1053 A--------------------------GFGLHELVTGL-RESG---D--EYGAILAKLLADRLAEAFAEALHVAVRRDLW 1100 Alistipes s...
WP_004328825   1056 G--------------------------GIGLKELTEKF-RAEG---D--DYNAILSKLLADRLTEALCEWVHIFIRRQMW 1103 Alistipes p...
WP_014623889   1053 A--------------------------GKDIERFLA-----EEgpgE--PYRELMVRLLADRLAEAASEYLHMLVRTTLW 1099 Spirochaeta...
CCY15354        149 V--------------------------DAGMEHLYD-----S----D--DYSRMLAQTLCDRLAEATAELLHRDVRRRYW 191  Prevotella ...
WP_013445490    158 I---------------------------QGVEAYAETFeKDD----D--VYHSILAKTLSDRLAEAAAEWLHFKVRREYW 204  Paludibacte...
WP_068690498   1041 V--------------------------------------SDRHncpDcrDFEHLLRESLCARLTEALAVWMQEQVND--- 1079 Culturomica...
jgi:Odosp_3416 1042 V--------------------------------------ADKQggcDchDFSHLLRESLCARLTEALAEWMQEQLSE--- 1080 Odoribacter...
CDA96507       1065 VvtnhgpactcgcqaglpdffarrvygRASGEDITSQLpETAT---K--DYNSMMDRAVRVTLAEAASLWLDDFLKK--- 1136 Bacteroides...
WP_014270523   1037 S--------------------------SLSIGEYLKEL-KEKG---D--DYRALSLQLICDRLVEVLAEKTERFLA-DRW 1083 Sphaerochae...
3BUL_A          465 GYAPNENLSNEELIRENYQGIRPAPGYPACPEHTEKATIWELLEVEKHTGMKLTESFAMWPGASVSGWYFSHPDSKYYAV 544 
CCZ98408       1101 GFEAGETMPVQEVLAGNYQGARMAFGYPAVPDHSLKKEVFRLLDAERITGMKLTDSYMIDPGESLCGMILADRHLKYFDV 1180 Alistipes s...
WP_004328825   1104 GYETGPALTPEQIIRSKYRGRRMAFGYPACPDHSLKREVFDLLAADKTTAMRLNDNYMITPEEALCGLFFAD--AEYFSV 1181 Alistipes p...
WP_014623889   1100 GYAPEEHLSPEEVLAGRYRGIRPAPGHAACPDHSLKQDIFELLGAEARLEVRLTESFMMVPPSSVAGFYFSHPESRYFAV 1179 Spirochaeta...
CCY15354        192 GYAPDEDLPLDDLLAGRFQGIRPAVGYPSLPDQSMVFLLDRVLHLGD-IGITLTESGAMRPHASTCGLMFSHPAARYFAV 270  Prevotella ...
WP_013445490    205 GYAPDENLSIKEMLKTTYSGIRPAVGYPSLPDQSIIFELEPLLKFTE-VGITLTENGAMFPNASVCGLYFAHPQSKYFMI 283  Paludibacte...
WP_068690498   1080 ------GLQM----------IRPAFGYPACPDHSLKKEVFELLDAPEKIGVTLTPSYAITPSTSICGMLIAHPEARYFGI 1143 Culturomica...
jgi:Odosp_3416 1081 ------GLSL----------IRPAFGYSACPDHSLKKDVFDLLDAPSKIGVSLTTSYAIYPTTSLCGMLIAHPAARYFSI 1144 Odoribacter...
CDA96507       1137 ------RMHCGR--GRNVRIVKPAAGYASCPDHTLKKDILDILPESGKLGIRLTESFAMIPDASICGFIFFHPDATYPEI 1208 Bacteroides...
WP_014270523   1084 GSK---NLGF----------IRPAPGYPAWSDHSEKKGIFDLLGATDAIGVRLTENFAMDPSSSICAMVFGGDDPRYFSV 1150 Sphaerochae...
3BUL_A          545 AQIQRDQVEDYARRKG 560 
CCZ98408       1181 GKIDAEQLADYARRRR 1196 Alistipes sp. CAG:157
WP_004328825   1182 GRIDREQLADYAARRN 1197 Alistipes putredinis
WP_014623889   1180 GRITEEQLRDYARRRE 1195 Spirochaeta thermophila
CCY15354        271 GPIDRRQFEDYARRRG 286  Prevotella sp. CAG:755
WP_013445490    284 GKIDENQFLDYAQRcg 299  Paludibacter propionicigenes
WP_068690498   1144 GEIGPDQFAAYCKNKG 1159 Culturomica massiliensis
jgi:Odosp_3416 1145 GKIGADQLTDYCTKRA 1160 Odoribacter splanchnicus DSM 20712
CDA96507       1209 RHISKEQFDDYASRRG 1224 Bacteroides sp. CAG:709
WP_014270523   1151 GNVSQEQLDQYAKAKG 1166 Sphaerochaeta pleomorpha
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap