4JCU


Conserved Protein Domain Family
CHMI

?
pfam02962: CHMI 
Click on image for an interactive view with Cn3D
5-carboxymethyl-2-hydroxymuconate isomerase
Statistics
?
PSSM-Id: 397215
Aligned: 97 rows
Threshold Bit Score: 160.335
Threshold Setting Gi: 668956442
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4JCU_B        24 PHLTLEYTDNLP-EPRIPELLQKLNGVLLARPdIFPVGGIRARAYRLSEYALADSSEPs---DAFVHLRLQIGAGRSEEV 99  Deinococcus rad...
EKF40041       2 PHAWVEYSANIEnEPEIRALGRCVYDAMIESG-IFPVAGIRVRMNRIDSYLVGDLKPE----HAFVHLSVRIGEGRSHEV 76  Nitratireductor...
KFC75084       2 PHIIVEYSANLEpALSLRRLVDELHRTALATG-VFPLGGLRTRAERRDIFAIADGDPT----HGFVAVLARIGEGRDAAT 76  Bosea sp. LC85
EBA09234       2 PHLRCEYSAGLEaHLDMEVLGRTLHTAMAGTG-VFPLGGIRVKMHRCSLAMVGDLNPGrgvvNHFLALELSVGAGRDKDV 80  Sagittula stell...
WP_008334843   2 PHLIVEYSPGLEdIVDMPAVLASLHDTLLSLD-PFPTAGIRVRAYRADHAIVADGHSD----NHFCALTMNVGHGRETEV 76  Maritimibacter ...
Q11FD3         2 PHLSIEYSAGLEtRTDVAGLCRALHGAMRETG-IFPLAGIRVRAHKADYTIVADGLAE----NDFVAMTLSVGSGRSVEA 76  Chelativorans s...
KEP71720       2 PHLTLEYSPGLAaRADIPALCRALHSAICEAG-IFPLGGIRVRAYCADHAIVGDGLPE----NDFAALGFAVASGRSPEA 76  Thioclava dalia...
WP_043753284   2 PHLSIEYSQGVGgDVRVEQLCRAVHAAMIEAG-IFPVAGIRVRAHRADVSIVADGLPQ----NDFVAMTLAVGTGRSTKA 76  Pseudooceanicol...
EEX12229       2 PHMRIEYSHGLTv-PEVESLCRAVHAAMVGAG-IFPLAGIRVRAFRADVAIVADGDAK----NDFAALTLSVGAGRSTEA 75  Citreicella sp....
WP_038133621   2 PHLRIEYSRGLDaRADIAALCQAVHGAMCAAG-IFPLAGIRVRAFCADHAIIADGLAE----NDFAAMTLSVGAGRSNDA 76  Thioclava indica
4JCU_B       100 KKETGDALFAVLTDHFAAEFAQRGLXLSAEISEFSEAGTWKKNNIHARY 148 Deinococcus radiodurans R1
EKF40041      77 KKAAADLIYERVSSHLKPLAGRSPLAFAFEMQEIPSAYSYKMNNLRQ-Y 124 Nitratireductor indicus C115
KFC75084      77 RRRVAEALIATLEAETADLFSKIGLGLTVEVQEIDGTASLKTNNLHERL 125 Bosea sp. LC85
EBA09234      81 LAEAGRQLFQVAEAVCADQLAAPHFLLSLEIREIDPELSWKANSIHARL 129 Sagittula stellata E-37
WP_008334843  77 LKAAGDAVFANAQAAFAVPLGQPHFALSLEIRVIDPVLTWKDTPIHGRL 125 Maritimibacter alkaliphilus
Q11FD3        77 LKQAGELIFAAARAALAEPLSTPHFALSLEIREIDPNLNWKETPIHARV 125 Chelativorans sp. BNC1
KEP71720      77 LRAAGDLIFAAARQALAEPLATPHFTLSFEIREINPDLSWKQNSIHARL 125 Thioclava dalianensis
WP_043753284  77 LQDAGGLIFRAAQGVLSDRLAEPHFALSLEIRQIDPDLSWKDTPIHARL 125 Pseudooceanicola atlanticus
EEX12229      76 LRAGGDLVFRAAQGALAHRLCEPHFALSLEIRVIDPELSWKDTPIHARL 124 Citreicella sp. SE45
WP_038133621  77 LRSAGDLIFAAAQKALEAPLATPHFALSLEIRVIDPELSWKQTPIHARL 125 Thioclava indica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap