Conserved Protein Domain Family
BESS

?
pfam02944: BESS 
BESS motif
The BESS motif is named after the proteins in which it is found (BEAF, Suvar(3)7 and Stonewall). The motif is 40 amino acid residues long and is composed of two predicted alpha helices. Based on the protein in which it is found and the presence of conserved positively charged residues it is predicted to be a DNA binding domain. This domain appears to be specific to drosophila.
Statistics
?
PSSM-Id: 397204
Aligned: 110 rows
Threshold Bit Score: 30.038
Threshold Setting Gi: 194170995
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WGS:AAQB:GK22897-PA  129 TSLYgGFLLDQLPFVEALSQLQRRRLEVEIVDAILQ 164  Drosophila willistoni
XP_001993575         107 NHVD-LFFDSVSSSVKALSPKLVAEAKMRVSQLICE 141  Drosophila grimshawi
WGS:AANI:GJ24412-PA   63 DSYD-LFFESACISIKSLPPKLAAEAKSRISQIITE 97   Drosophila virilis
WGS:AAPP:GF17398-PA  300 DSVE-LFFDSICATVKSLPPKLATEGKIRVMQLIGE 334  Drosophila ananassae
WGS:AANI:GJ10411-PA  919 DTID-LFFESITQTMKTLPGDLAAEGKAKIMQIVCD 953  Drosophila virilis
WGS:AAQB:GK22413-PB  815 hVMD-LFLDSISATMKDLPSDLAAKGKAKIMQIVCD 849  Drosophila willistoni
WGS:AAPP:GF17587-PA  970 hVVD-LFFDSIAPTMKALPADLAAEGKAKIMQLVCG 1004 Drosophila ananassae
XP_003240649         189 DDVD-FFLKSLGITIKKLPPQLIIQAKVKMLSIIMD 223  pea aphid
XP_011677772         173 DELD-SFFKTISATVRKLTPVLQSQLRFQIMEMVYK 207  purple sea urchin
XP_003240720         216 DETD-LFFQSIAAMVKKLPPKGTSEARLQILKTVse 250  pea aphid
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap