1BCM


Conserved Protein Domain Family
DDE_2

?
pfam02914: DDE_2 
Click on image for an interactive view with Cn3D
Bacteriophage Mu transposase
Statistics
?
PSSM-Id: 397179
Aligned: 2 rows
Threshold Bit Score: 455.998
Threshold Setting Gi: 7388319
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1BCM_B  10 VEHLDAMQWINGDGYLHNVFVRWFNGDVIRPKTWFWQDVKTRKILGWRCDVSENIDSIRLSFMDVVTRYGIPEdfHITID 89  Escherichia phage Mu
O05069 267 VAMLQAMEWINGDGYQHNVWVRFPDGEIKRPKTWLWQDVRTRKVLAARTDKSENTDTIRLSLLDVISRYGLPK--HLTID 344 Haemophilus influenza...
1BCM_B  90 NTRGAANKWLTGGAPNRYRFKVKEDDPKGLFLLMGAKMHWTSVVAGKGWGQAKPVERAFGVGGLEEYVDKHPALAGAYTG 169 Escherichia phage Mu
O05069 345 NTRAAANKKMTGGVKNRYRYQVNENEVQGIIPALGIELHWTSIQFGKGRGQAKPIERAFSHGGLGDYVDKHLLLRGAYAG 424 Haemophilus influenza...
1BCM_B 170 PNPQAKPD----NYGDRAVDAELFLKTLAEGVAMFNARTGRETEMCGGKLSFDDVFEREYA 226 Escherichia phage Mu
O05069 425 ANAYEKPDydgkNGAEQPVDYATFLMALEQGIQQWNNVGNRLTEICAGKSSYAEAFERDWA 485 Haemophilus influenzae Rd KW20
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap