3PCO,1EIY


Conserved Protein Domain Family
Phe_tRNA-synt_N

?
pfam02912: Phe_tRNA-synt_N 
Click on image for an interactive view with Cn3D
Aminoacyl tRNA synthetase class II, N-terminal domain
Statistics
?
PSSM-Id: 397177
Aligned: 765 rows
Threshold Bit Score: 42.7549
Threshold Setting Gi: 222418913
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3PCO_C        19 SDVAALDNVRVEYLGKKGHLTLQMTTLRELPPEERPAAGAVINEAKEQVQQALNARKAELESAALNA 85  Escherichia coli
WP_003773797  18 ETLEHLNDVRIEYLSKKGLLTKVMGQMKDLSNEEKPLFGKRVNEAKQSIESALKEKQTDLEAVKLKK 84  Erysipelothrix rhusiopathiae
CBJ30142     107 TTLQELEDLRRKYMTKKGPVQKVMGQMRLLSPEDKPKLGKVSNVVKASLEETLKSSKDALENAAVEA 173 Ectocarpus siliculosus
XP_002176883  32 TSVADAEVIRREYLGKKGPINKAMGYMRLLPNEDKPKLGAVVNEIKEALETTMTERMDALKVAEIEA 98  Phaeodactylum tricornutum CC...
Q5NG53        19 KDKKTLDDIRVKYLGKKGELTEMMKLIATLPNDEKPKLGQAVNIAKQALQEAINLKLANFEEQELNE 85  Francisella tularensis subsp...
Q8EFA0        19 SDLKALDDIRVDYLGKKGKITDMMKMMGSLSPEEKPAFGQAVNDAKQAIQQKLTERIDGLKSAELEA 85  Shewanella oneidensis MR-1
A1S702        19 TDLKVLDDIRVDYLGKKGQITDLMKLMGTLSAEEKPKFGQAVNDAKQSVQAKLGEQMELFKARELEA 85  Shewanella amazonensis SB2B
Q5HQ36        22 NDAQALQEVKVKYLGKKGSVSALMKNMKDLPNEEKPAYGQKVNELRQTIQSELDERQKLIKEEKLNQ 88  Staphylococcus epidermidis R...
B9E766        22 TDKKALQDIKVSYIGKKGVITGLMKEMKSLPNEEKPMFGQLVNDAKQTVESAIAEVEARIEAELVNK 88  Macrococcus caseolyticus JCS...
Q82VV5        25 ESIVDLEQIKAQYLGKTGEITILLKGLRELTPEERPVMGERINQAKKLLEDALIERRNLIQEKNMSA 91  Nitrosomonas europaea ATCC 1...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap