5XMJ,2BS4


Conserved Protein Domain Family
Succ_DH_flav_C

?
pfam02910: Succ_DH_flav_C 
Click on image for an interactive view with Cn3D
Fumarate reductase flavoprotein C-term
This family contains fumarate reductases, succinate dehydrogenases and L-aspartate oxidases.
Statistics
?
PSSM-Id: 397175
Aligned: 673 rows
Threshold Bit Score: 73.6064
Threshold Setting Gi: 375751446
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5XMJ_E               469 RDEMHDIMMEGVGIFRNGTDLQKAVNKLEELYDR-SQKISLSSACKGMNPELSTALRIRGMLKLAQCTAYGALDRTESRG 547 Desulfo...
WP_015070549         541 HRRLGDILYDHCGVSRDETGLVEGLEQVRALREEfWRDVRVVGDGDRLNQELEKAGRVADFIELGETMILDALDRRESAG 620 Acidipr...
jgi:Cfla_1917        526 HRRLGEILYRSAGVTRTPEGLAEGIADVRALREEfWQDVRVTGEGDVLNQELERAGRVADYLEMAELLCVDALDRDESCG 605 Cellulo...
BAG29099             522 HRRLGDLLYAKCGVTRSAEGLAEGLEGIRALREEfWTDLRVQGRPDGFNQELERAGRVADYLDMAELMCLDALDRDESAG 601 Kocuria...
CeBiTec:A605_01905   535 HRQLGEILYFACGVSRNVKDLTEAIGKIRALREDfWTNVQVPGEQNYMNQALEYAARVADYIDLGELMCIDALDRDESCG 614 Coryneb...
WP_012359468         543 HRQLGEILYFSCGVSRNVEDMKDGIEKIRALRKEfWANVHVPGEANEMNQELEYALRVADYLDLGELMCVDALDRDESCG 622 Coryneb...
WP_005287045         590 HEQLGAILYESCGVARNVENMEKGLERVRELRREfWANVNIPGDAMDMNQTLENAIRVADYINLGELMIIDALDRDESCG 669 Coryneb...
WP_012732549         545 HRKLGDILYFSCGVSRNVENLEKGIKDIRELRDEfWQNLHIPGDVDNLNQVLEYANRVADYMDLAELMCVDAMDRDESCG 624 Coryneb...
WP_013241102         536 HRQLGDILYFSCGVARNVEDLKTGIEKIRKLRKEfWSNLRITGEAEEMNQVLEYACRVADYIDLGELMCVDALDRDESCG 615 Coryneb...
goetting:GPOL_c36140 524 HRTLGEILYRGCGVARSPEGLSTAIDEIRALREQfWSDVRVVGTGAQFNQELERAGRVADFLELAELMCVDALDRDESCG 603 Gordoni...
5XMJ_E               548 AHTREDFPE------RNDKEWLNRTLSywkegasmptlEY-----------------EEASPYYEmPPGDRGY 597 Desulfovibrio ...
WP_015070549         621 AHFRTEYATpegearRDDANWAAVSAW-----------ETtpege-------hvrhsEPLAFSLI-ALQVRDY 674 Acidipropionib...
jgi:Cfla_1917        606 AHFRADHQTpggeaqRDDAAWCRVSAW-----------ESpapgatd---arfvrhdEPLTFQAV-PLQTRNY 663 Cellulomonas f...
BAG29099             602 AHFRDEHQTeggeaqRDDAHWLFASAW-----------ERvgsddaaphgpryvrhqEHLEFPSV-PPETRDY 662 Kocuria rhizop...
CeBiTec:A605_01905   615 AHYRDDHLSedgeaeRDDENWCFVSAW-----------EPagedk-------fvrhaEPLYFESI-PLQTRNY 668 Corynebacteriu...
WP_012359468         623 AHYRDDHLSedgeaeRDDDNWCFVSAW-----------ESngdek-------firhsEPLYFDRI-PLMTRNY 676 Corynebacteriu...
WP_005287045         670 AHYREDHLSedgeaeRDDENWCFVSAW-----------EPagdeq-------firhaEPLYFDSI-PLMTRNY 723 Corynebacteriu...
WP_012732549         625 AHYRDDHLSedgeaeRDDSKWCFVSAW-----------EHngdgk-------firhaEPLYFDRI-PLMTRNY 678 Corynebacteriu...
WP_013241102         616 AHFREDHLSsegeaeRDDENWCFVSAW-----------EPgaqehe------firhaEPLTFESI-PLMTRNY 670 Corynebacteriu...
goetting:GPOL_c36140 604 AHFRVDHQTeqgeavRDDDHWCFASAW-----------ETtdagr-------hirhrEPLSFHAV-PLQTRNY 657 Gordonia polyi...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap