3I2D


Conserved Protein Domain Family
zf-MIZ

?
pfam02891: zf-MIZ 
MIZ/SP-RING zinc finger
This domain has SUMO (small ubiquitin-like modifier) ligase activity and is involved in DNA repair and chromosome organisation.
Statistics
?
PSSM-Id: 397158
Aligned: 32 rows
Threshold Bit Score: 73.8298
Threshold Setting Gi: 122052608
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3I2D_A        248 MSLQCPISYTRMKYPSKSINCKHLQCFDALWFLHSQLQIPTWQCPVCQI 296 
Q680Q4        359 VNLRCPMSGSRIKVAGRFLPCVHMGCFDLDVFVELNQRSRKWQCPICLK 407  thale cress
Q4D897        311 VTLRCPLSYQRIRVAGKGKHCVHLACFDVVTYLESSLRSSTWNCPICDG 359  Trypanosoma cruzi
Q4Q6T7        259 VKIQCPITTLTMEIPVRGMYCEHLQCMELAAVLIQCARQNVWNCPLCSA 307  Leishmania major
Q586F5        424 VRAVCPITALPLSVPVRACGCEHVQCIELQAVLMHCDRTNVWNCPLCWA 472  Trypanosoma brucei
Q4CSC6        405 VKINCPITTLPLSIPVRGHLCEHMQCVELRSLLMQCARTNVWNCPLCWA 453  Trypanosoma cruzi
Q38DR7        457 ITTKCPISQARISIPIRGAHCAHLQCFDCRSFLQGCHSGCYWNCPLCDS 505  Trypanosoma brucei
XP_003722792  500 ITTKCPISQLPLSVPVRGSRCTHLQCVDLNAFLVSSNKASYWNCALCDA 548  Leishmania major strain Friedlin
Q555X5        473 LTVRCPLSFKRIEYPAKSKKCTHNQCFDLCSFTEYSNQQQLWNCPICHA 521  Dictyostelium discoideum AX4
Q54V57        820 ITVRCILKNSRMILPIKSENCTHHQCFDLRNYLKHCQKIQLWNCPICNV 868  Dictyostelium discoideum AX4
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap