3LPG,3T0B,3OB8,3HN3


Conserved Protein Domain Family
Glyco_hydro_2_C

?
pfam02836: Glyco_hydro_2_C 
Click on image for an interactive view with Cn3D
Glycosyl hydrolases family 2, TIM barrel domain
This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
Statistics
?
PSSM-Id: 397119
Aligned: 8 rows
Threshold Bit Score: 394.507
Threshold Setting Gi: 312207880
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3LPG_B        276 VAVKG-EQFLINHKPFYFTGFGRHEDADLRGKGFDNVLXVHDHALXDWIGANSYRTSHYPYAEEXLDWADEHGIVVIDET 354  Escherichia c...
3T0B_A        364 VRIEN-GLLLLNGKPLLIRGVNRHEHHPLHGQVMDEQTMVQDILLMKQNNFNAVRCSHYPNHPLWYTLCDRYGLYVVDEA 442  Escherichia c...
3OB8_D        340 VELKD-GNITVNGKDILFRGVNRHDHHPRFGRAVPLDFVVRDLILMKKFNINAVRNSHYPNHPKVYDLFDKLGFWVIDEA 418  Kluyveromyces...
P06864        320 IKVRD-GLFWINNRYVMLHGVNRHDNDHRKGRAVGMDRVEKDLQLMKQHNINSVRTAHYPNDPRFYELCDIYGLFVMAET 398  Escherichia c...
P12265        325 VAVTK-SKFLINGKPFYFQGVNKHEDSDIRGKGFDWPLLVKDFNLLRWLGANSFRTSHYPYSEEVLQLCDRYGIVVIDEC 403  house mouse
3HN3_D        309 VAVTK-SQFLINGKPFYFHGVNKHEDADIRGKGFDWPLLVKDFNLLRWLGANAFRTSHYPYAEEVMQMCDRYGIVVIDEC 387  human
Q5M3K5        324 FEIKD-KLMLLNGKRIVFKGVNRHEFNARTGRCITEEDMLWDIKVMKQHNINAVRTSHYPNQTRWYELCDEYGLYVIDEA 402  Streptococcus...
WP_076633326  154 vELRDdKVIYVNNKRLVINGVNRHEWNAHTGRVISMDDMRADIQTMLANNINADRTCHYPDQLPWYQLCDEAGIYLMAEN 233  Lactobacillus...
3LPG_B        355 AAVGFNLSLGIGfeagnkp----------kelyseEAVNGETQQAHLQAIKELIARDKNHPSVVXWSIANEPdtrpqGAR 424  Escherichia c...
3T0B_A        443 NIETHGMVPMNR-----------------------LTDDPRWLPAMSERVTRMVQRDRNHPSVIIWSLGNES-----GHG 494  Escherichia c...
3OB8_D        419 DLETHGVQEPFNrhtnleaeypdtknklydvnahyLSDNPEYEVAYLDRASQLVLRDVNHPSIIIWSLGNEA-----CYG 493  Kluyveromyces...
P06864        399 DVESHGFAN-VGdi-------------------srITDDPQWEKVYVERIVRHIHAQKNHPSIIIWSLGNES-----GYG 453  Escherichia c...
P12265        404 PGVGIVLPQSFG---------------------------NESLRHHLEVMEELVRRDKNHPAVVMWSVANEPssalkPAA 456  house mouse
3HN3_D        388 PGVGLALPQFFNnv---------------------------sLHHHMQVMEEVVRRDKNHPAVVMWSVANEPashleSAG 440  human
Q5M3K5        403 NLETHGTWQKLGlcep---------------swniPASEPEWLPACLDRANNMFQRDKNHASVIIWSCGNES-----YAG 462  Streptococcus...
WP_076633326  234 NLESHGSWQKMGaiep---------------synvPGDNPHWLAAVIDRARSNYEWFKNHPSIIFWSLGNES-----YAG 293  Lactobacillus...
3LPG_B        425 EYFAPLAEATRKLDPTRPITCVNVxfcdahtDtISDLFDVLCLNRYYGWYVQSGDLETaekvLEKELLAWq--------- 495  Escherichia c...
3T0B_A        495 ANHDALYRWIKSVDPSRPVQYEGG-------G-ADTTATDIICPMYARVDEDQPFPAVpkwsIKKWLSLP---------- 556  Escherichia c...
3OB8_D        494 RNHKAMYKLIKQLDPTRLVHYEGD-------------LNALSADIFSFMYPTFEIMER----WRKNHTDEn--------- 547  Kluyveromyces...
P06864        454 CNIRAMYHAAKALDDTRLVHYEED---------RDAEVVDII----STMYTRVPLMNE----FGEYPHP----------- 505  Escherichia c...
P12265        457 YYFKTLITHTKALDLTRPVTFVSNaky-dadL-GAPYVDVICVNSYFSWYHDYGHLEViqpqLNSQFENWy--------- 525  house mouse
3HN3_D        441 YYLKMVIAHTKSLDPSRPVTFVSNsnyaadkG--APYVDVICLNSYYSWYHDYGHLELiqlqLATQFENWy--------- 509  human
Q5M3K5        463 KDIADMADYFRSVDNTRPVHYEGV-------A-WCREFDYIT-DIESRMYAK---PAD----IEEYLTTGklvdlssvsd 526  Streptococcus...
WP_076633326  294 EDIAAMQAFYKEHDDSRLVHYEGV-------V-HTPELKDRISDVESRMYEK---PQN----IVAYLED----------- 347  Lactobacillus...
3LPG_B        496 ---------eKLHQPIIITEYGVDTLA--GLHSXYTDXWS--EEYQCAWLDXYHRVFD--RVSAvVG----EQVWNFADF 556  Escherichia c...
3T0B_A        557 ----------GETRPLILCEYAHAMGNslGGFAKYWQAFRqyPRLQGGFVWDWVDQSLikYDEN-GN----PWSAYGGDF 621  Escherichia c...
3OB8_D        548 ---------gKFEKPLILCEYGHAMGNgpGSLKEYQELFYkeKFYQGGFIWEWANHGIefEDVStADgklhKAYAYGGDF 618  Kluyveromyces...
P06864        506 -------------KPRIICEYAHAMGNgpGGLTEYQNVFYkhDCIQGHYVWEWCDHGIqaQDDH-GN----VWYKFGGDY 567  Escherichia c...
P12265        526 ---------kTHQKPIIQSEYGADAIP--GIHEDPPRMFS--EEYQKAVLENYHSVLDqkRKEYvVG----ELIWNFADF 588  house mouse
3HN3_D        510 ---------kKYQKPIIQSEYGAETIA--GFHQDPPLMFT--EEYQKSLLEQYHLGLDqkRRKYvVG----ELIWNFADF 572  human
Q5M3K5        527 khfasgnltnKPQKPYISCEYMHTMGNsgGGLQLYTDLEKy-PEYQGGFIWDFIDQAIykTLPN-GS----EFLSYGGDW 600  Streptococcus...
WP_076633326  348 ----------NPTKPFLDCEYMHDMGNslGGMQSYNDLIDkyPMYQGGFIWDFIDQALfvHDPItDQ----DVLRYGGDF 413  Lactobacillus...
3LPG_B        557 ATSQGILRVGGNkkGIFTRDRKPKSAAFLLQKRWTGXNF 595  Escherichia coli K-12
3T0B_A        622 GDTPNDRQFCMN--GLVFADRTPHPALTEAKHQQQFFQF 658  Escherichia coli K-12
3OB8_D        619 KEEVHDGVFIMD--GLCNSEHNPTPGLVEYKKVIEPVHI 655  Kluyveromyces lactis
P06864        568 GDYPNNYNFCLD--GLIYSDQTPGPGLKEYKQVIAPVKI 604  Escherichia coli K-12
P12265        589 MTNQSPLRVIGNkkGIFTRQRQPKTSAFILRERYWRIAN 627  house mouse
3HN3_D        573 MTEQSPTRVLGNkkGIFTRQRQPKSAAFLLRERYWKIAN 611  human
Q5M3K5        601 HDRPSDYEFCGN--GIVFADRTLTPKLQTVKHLYSNIKI 637  Streptococcus thermophilus LMG 18311
WP_076633326  414 DERHSDYEFSGD--GLMFADRTPKPAMQEVKYYYGLhk- 449  Lactobacillus plantarum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap