5T4O,2E5Y,6FKF,5DN6,5YIO,6Q45


Conserved Protein Domain Family
ATP-synt_DE_N

?
pfam02823: ATP-synt_DE_N 
ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Part of the ATP synthase CF(1). These subunits are part of the head unit of the ATP synthase. The subunit is called epsilon in bacteria and delta in mitochondria. In bacteria the delta (D) subunit is equivalent to the mitochondrial Oligomycin sensitive subunit, OSCP (pfam00213).
Statistics
?
PSSM-Id: 397109
Aligned: 220 rows
Threshold Bit Score: 62.8395
Threshold Setting Gi: 123722782
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5T4O_H   6 HLDVVSAEQQMFSGL-VEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVkQHGHEEFI-YLSGGILEVQPGNVTVLADT 83 
Q6MAK8   4 PLSILTSEKNVFNED-VYSVNVPGADGYFEVLAHHATVIALLQPGKLTIInKDHQKLYF-GITTGFIEVSHNSATIIADA 81  Candidatus Protochlam...
Q15SF6   2 DVNILLPYQVFATLGdVTNLVIETPSGSHGILPQRLDCISPLVPGILTYQqGAQQSQFI-AIDQGIMVKTGAQVMISVRR 80  Pseudoalteromonas atl...
Q2Y8G3   2 DLKILLPFSVFMEKArVDRIVVETVDGSLGLLPHRLDCVAALVPGILIFEtRSEGEIYV-AVDEGILVKVSAQVTVSVRN 80  Nitrosospira multifor...
A0Q2Z3   6 KLKIVTPEKIFFEGE-AEKINLETTEGKTEILANHSAFIAMLVPTNSKLItDKGEEKKF-FLSSGILKVNTEEVVILCDA 83  Clostridium novyi NT
P50009   6 RLKIIAPTGVFFDDD-IERVVIRGIEGELAILAEHTPLTTNVAIGTFNIIfAD-KKKKNgTLLGGIATINPRETIILTDA 83  Acetobacterium woodii...
Q8YAM5   2 KLKIVSPMGQFFEGE-VEGFVINTKEGQQTVLEEHIDCLSFFDYSEISIL-DAVASDPI-FVALGYLHLVQNEANIMAQF 78  Listeria monocytogenes
Q6KI83   7 KLIITTPQGYFFNDD-VEIVTLKTTEGYIGIQKDSQSLIASIKPSKLFINqINSKDLKIcAISGGIAFIDKNEIKIITDA 85  Mycoplasma mobile 163K
Q98QU6   4 QLIITTPNGIFFNEK-VDIVTVVTAGGHIGIQYGHQPLISTIEISELHINtEGHKDYRIcSINGGLLYVEKDKANIITGA 82  Mycoplasma pulmonis U...
Q4A605   5 KLTITTPSAIFYDDL-VDIVTLRVNLGYKGFLPNASEFFSNIEPGTLTINyENSSDMIKcHIGSGLIYSNKESVNIITDD 83  Mycoplasma synoviae 53
5T4O_H  84 A 84 
Q6MAK8  82 I 82  Candidatus Protochlamydia amoebophila UWE25
Q15SF6  81 A 81  Pseudoalteromonas atlantica T6c
Q2Y8G3  81 A 81  Nitrosospira multiformis ATCC 25196
A0Q2Z3  84 A 84  Clostridium novyi NT
P50009  84 A 84  Acetobacterium woodii DSM 1030
Q8YAM5  79 a 79  Listeria monocytogenes
Q6KI83  86 I 86  Mycoplasma mobile 163K
Q98QU6  83 I 83  Mycoplasma pulmonis UAB CTIP
Q4A605  84 I 84  Mycoplasma synoviae 53
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap